Homologs in group_1223

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06675 FBDBKF_06675 100.0 Morganella morganii S1 gsiA ABC-type glutathione transport system ATPase component, contains duplicated ATPase domain
NLDBIP_10100 NLDBIP_10100 100.0 Morganella morganii S4 gsiA ABC-type glutathione transport system ATPase component, contains duplicated ATPase domain
LHKJJB_07655 LHKJJB_07655 100.0 Morganella morganii S3 gsiA ABC-type glutathione transport system ATPase component, contains duplicated ATPase domain
HKOGLL_07205 HKOGLL_07205 100.0 Morganella morganii S5 gsiA ABC-type glutathione transport system ATPase component, contains duplicated ATPase domain
F4V73_RS15265 F4V73_RS15265 93.2 Morganella psychrotolerans - ATP-binding cassette domain-containing protein
PMI_RS12425 PMI_RS12425 61.0 Proteus mirabilis HI4320 - ATP-binding cassette domain-containing protein

Distribution of the homologs in the orthogroup group_1223

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1223

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P50980 1.83e-26 108 30 6 252 3 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. cremoris (strain SK11)
Q07733 4.7e-26 107 30 6 252 1 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. lactis (strain IL1403)
P33916 5.85e-24 103 33 8 257 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 3.38e-11 66 30 8 213 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P42064 7.5e-24 101 28 5 256 3 appD Oligopeptide transport ATP-binding protein AppD Bacillus subtilis (strain 168)
Q32IB5 9.21e-24 103 28 8 273 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q32IB5 2.01e-15 79 29 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
P63396 2.21e-23 102 34 6 233 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P63396 1.83e-06 52 26 6 233 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQJ5 2.21e-23 102 34 6 233 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ5 1.83e-06 52 26 6 233 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ4 2.21e-23 102 34 6 233 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQJ4 1.83e-06 52 26 6 233 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q0TJM0 3.07e-23 102 28 8 275 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TJM0 8.13e-15 77 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FJL0 3.64e-23 101 28 8 275 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FJL0 9.72e-15 77 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X6W1 3.9e-23 101 28 8 273 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q8X6W1 1.37e-15 79 29 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
A1A967 4.09e-23 101 28 8 275 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
A1A967 1.02e-13 73 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
Q1RE96 4.29e-23 101 28 8 275 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q1RE96 7e-15 77 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
P77268 4.65e-23 99 33 7 240 2 ddpD Probable D,D-dipeptide transport ATP-binding protein DdpD Escherichia coli (strain K12)
Q323W5 4.99e-23 101 28 8 273 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q323W5 7.41e-15 77 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q3Z3V4 6.04e-23 101 28 8 273 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
Q3Z3V4 9.9e-15 77 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
P75796 6.71e-23 100 28 8 273 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
P75796 1.04e-14 77 28 4 232 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
A0A0H3JXA3 9.8e-23 97 29 6 226 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FVF0 3.82e-22 95 29 6 226 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain NCTC 8325 / PS 47)
A9CKL2 3.94e-22 98 33 6 235 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
A9CKL2 2.09e-10 63 25 6 229 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1R5D9 6.12e-22 94 32 7 243 3 nikD Nickel import ATP-binding protein NikD Escherichia coli (strain UTI89 / UPEC)
Q0TBX9 6.12e-22 94 32 7 243 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q83LT3 6.72e-22 98 28 8 273 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q83LT3 1.54e-14 76 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q0T6D3 6.92e-22 98 28 8 273 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q0T6D3 1.61e-14 76 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q8FCN0 1.75e-21 93 32 7 243 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A0A0H2ZGN6 1.92e-21 94 32 9 248 1 dppD Di/tripeptide transport ATP-binding protein DppD Pseudomonas aeruginosa (strain UCBPP-PA14)
Q32AQ2 2.73e-21 92 32 7 243 3 nikD Nickel import ATP-binding protein NikD Shigella dysenteriae serotype 1 (strain Sd197)
Q0SZJ4 5.18e-21 92 32 7 243 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri serotype 5b (strain 8401)
Q83J78 5.23e-21 92 32 7 243 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri
Q3YW49 6.9e-21 92 32 8 244 3 nikD Nickel import ATP-binding protein NikD Shigella sonnei (strain Ss046)
Q31VE7 7.05e-21 92 32 8 244 3 nikD Nickel import ATP-binding protein NikD Shigella boydii serotype 4 (strain Sb227)
P33593 1.1e-20 91 32 7 243 3 nikD Nickel import ATP-binding protein NikD Escherichia coli (strain K12)
Q2YK63 2.4e-20 92 29 6 249 3 BAB2_0817 Putative peptide import ATP-binding protein BAB2_0817 Brucella abortus (strain 2308)
Q577J5 2.4e-20 92 29 6 249 3 BruAb2_0796 Putative peptide import ATP-binding protein BruAb2_0796 Brucella abortus biovar 1 (strain 9-941)
P24136 2.85e-20 92 30 7 237 1 oppD Oligopeptide transport ATP-binding protein OppD Bacillus subtilis (strain 168)
Q5PGP3 3.27e-20 93 28 7 243 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PGP3 3.24e-17 84 29 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57RB2 3.46e-20 93 28 7 243 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q57RB2 1.23e-17 85 30 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q8ZQM4 3.7e-20 93 28 7 243 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZQM4 1.27e-17 85 30 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8FWP1 3.97e-20 91 28 7 268 3 BRA0405 Putative peptide import ATP-binding protein BRA0405/BS1330_II0402 Brucella suis biovar 1 (strain 1330)
Q8X5U1 4.04e-20 89 32 7 243 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O157:H7
Q8YDH0 7.39e-20 90 30 7 250 3 BMEII0206 Putative peptide import ATP-binding protein BMEII0206 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YBN6 1.14e-19 90 29 6 249 3 BMEII0863 Putative peptide import ATP-binding protein BMEII0863 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8Z864 1.25e-19 91 28 7 243 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q8Z864 1.26e-17 85 30 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
A5VU87 1.69e-19 89 29 6 249 3 BOV_A0348 Putative peptide import ATP-binding protein BOV_A0348 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P45095 5.19e-19 88 31 8 264 3 dppD Dipeptide transport ATP-binding protein DppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A2U9 6.86e-19 88 29 7 237 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U8 6.86e-19 88 29 7 237 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8FUW8 8.82e-19 87 29 8 251 3 BRA1094 Putative peptide import ATP-binding protein BRA1094/BS1330_II1086 Brucella suis biovar 1 (strain 1330)
Q2YJJ9 8.82e-19 87 29 8 251 3 BAB2_1052 Putative peptide import ATP-binding protein BAB2_1052 Brucella abortus (strain 2308)
Q8VQK6 8.82e-19 87 29 8 251 3 BruAb2_1033 Putative peptide import ATP-binding protein BruAb2_1033 Brucella abortus biovar 1 (strain 9-941)
Q87JM4 1.01e-18 89 35 9 216 3 macB Macrolide export ATP-binding/permease protein MacB Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q53193 1.22e-18 87 29 8 241 3 NGR_a01410 Probable peptide ABC transporter ATP-binding protein y4tR Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0AAG2 1.26e-18 87 29 6 241 3 dppD Dipeptide transport ATP-binding protein DppD Shigella flexneri
P0AAG0 1.26e-18 87 29 6 241 1 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli (strain K12)
P0AAG1 1.26e-18 87 29 6 241 3 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli O157:H7
Q4W575 1.79e-18 87 35 9 227 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVH1 1.79e-18 87 35 9 227 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
O34677 3.44e-18 84 28 5 220 2 glnQ Glutamine transport ATP-binding protein GlnQ Bacillus subtilis (strain 168)
Q6G1V5 3.72e-18 87 35 7 205 3 macB Macrolide export ATP-binding/permease protein MacB Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q50966 3.95e-18 85 32 6 225 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae
A2RI77 5.12e-18 85 26 5 237 1 dppD Dipeptide transport ATP-binding protein DppD Lactococcus lactis subsp. cremoris (strain MG1363)
Q5FA19 5.21e-18 85 33 9 228 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q2YJJ8 5.34e-18 85 30 5 239 3 BAB2_1053 Putative peptide import ATP-binding protein BAB2_1053 Brucella abortus (strain 2308)
Q8VQK7 5.34e-18 85 30 5 239 3 BruAb2_1034 Putative peptide import ATP-binding protein BruAb2_1034 Brucella abortus biovar 1 (strain 9-941)
P0CZ33 6e-18 84 25 6 260 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XDU4 6e-18 84 25 6 260 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ32 6e-18 84 25 6 260 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0A2V6 6e-18 84 25 6 260 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M1
P45051 9.58e-18 84 26 4 233 3 oppF Oligopeptide transport ATP-binding protein OppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P26905 1.16e-17 84 29 5 237 3 dppD Dipeptide transport ATP-binding protein DppD Bacillus subtilis (strain 168)
Q2IXX0 1.32e-17 85 36 9 211 3 macB Macrolide export ATP-binding/permease protein MacB Rhodopseudomonas palustris (strain HaA2)
Q8YDH1 1.99e-17 84 30 5 239 3 BMEII0205 Putative peptide import ATP-binding protein BMEII0205 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P04285 2.76e-17 83 28 7 245 1 oppD Oligopeptide transport ATP-binding protein OppD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8P2L5 3.58e-17 82 25 6 260 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q8RDH4 3.64e-17 82 30 7 232 1 dppD Dipeptide transport ATP-binding protein DppD Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P45052 4.31e-17 82 27 6 235 3 oppD Oligopeptide transport ATP-binding protein OppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P76027 6.13e-17 82 28 7 236 1 oppD Oligopeptide transport ATP-binding protein OppD Escherichia coli (strain K12)
Q9I190 1.58e-16 82 35 8 203 1 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02MI4 1.58e-16 82 35 8 203 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8RD07 1.72e-16 79 30 4 219 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q2FVF1 1.72e-16 79 27 8 236 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q83LR7 3.01e-16 81 35 7 203 3 macB Macrolide export ATP-binding/permease protein MacB Shigella flexneri
Q9CM47 3.01e-16 81 32 10 233 3 macB Macrolide export ATP-binding/permease protein MacB Pasteurella multocida (strain Pm70)
A0A0H3JT74 3.25e-16 79 28 8 236 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q217L2 3.35e-16 81 34 9 213 3 macB Macrolide export ATP-binding/permease protein MacB Rhodopseudomonas palustris (strain BisB18)
A1RG29 3.69e-16 81 34 8 197 3 macB Macrolide export ATP-binding/permease protein MacB Shewanella sp. (strain W3-18-1)
Q81CT8 4.24e-16 80 28 6 224 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 1.46e-07 55 29 7 188 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2YXY9 5.54e-16 78 25 7 225 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q5L5Z1 7.82e-16 79 28 10 249 3 metN Methionine import ATP-binding protein MetN Chlamydia abortus (strain DSM 27085 / S26/3)
Q9Z8Q8 9.32e-16 79 30 8 226 3 metN Methionine import ATP-binding protein MetN Chlamydia pneumoniae
Q1CGD7 1.06e-15 80 33 7 203 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q66CL2 1.06e-15 80 33 7 203 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q7CHI2 1.06e-15 80 33 7 203 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis
Q1CA99 1.06e-15 80 33 7 203 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis bv. Antiqua (strain Antiqua)
Q1I7I9 1.08e-15 80 35 10 213 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas entomophila (strain L48)
Q32DZ9 1.16e-15 79 35 9 204 3 macB Macrolide export ATP-binding/permease protein MacB Shigella dysenteriae serotype 1 (strain Sd197)
Q8EIL8 1.25e-15 79 33 10 222 3 macB Macrolide export ATP-binding/permease protein MacB Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q82VK1 1.29e-15 79 33 9 213 3 macB Macrolide export ATP-binding/permease protein MacB Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P44513 1.58e-15 78 32 7 219 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q12R52 1.9e-15 77 31 10 251 3 hmuV Hemin import ATP-binding protein HmuV Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
P24137 1.9e-15 77 27 5 234 1 oppF Oligopeptide transport ATP-binding protein OppF Bacillus subtilis (strain 168)
Q8YBN5 2.05e-15 77 27 4 233 3 BMEII0864 Putative peptide import ATP-binding protein BMEII0864 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWP2 2.05e-15 77 27 4 233 3 BRA0404 Putative peptide import ATP-binding protein BRA0404/BS1330_II0401 Brucella suis biovar 1 (strain 1330)
Q2YK62 2.05e-15 77 27 4 233 3 BAB2_0818 Putative peptide import ATP-binding protein BAB2_0818 Brucella abortus (strain 2308)
Q577J4 2.05e-15 77 27 4 233 3 BruAb2_0797 Putative peptide import ATP-binding protein BruAb2_0797 Brucella abortus biovar 1 (strain 9-941)
A5VU86 2.05e-15 77 27 4 233 3 BOV_A0347 Putative peptide import ATP-binding protein BOV_A0347 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q6D3A9 2.15e-15 79 27 6 244 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D3A9 6.09e-14 74 27 8 236 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P75831 2.26e-15 79 34 7 203 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain K12)
Q1JII9 2.34e-15 78 26 9 287 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q8XED0 2.35e-15 79 34 7 203 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O157:H7
Q6GH27 2.44e-15 77 25 7 225 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MRSA252)
Q7A5Q8 2.44e-15 77 25 7 225 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain N315)
Q99UA2 2.44e-15 77 25 7 225 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0CZ31 2.53e-15 78 26 9 287 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ30 2.53e-15 78 26 9 287 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P18766 2.55e-15 77 25 5 236 3 amiF Oligopeptide transport ATP-binding protein AmiF Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q02592 2.6e-15 79 29 7 231 2 hmt1 Heavy metal tolerance protein Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q1RE44 2.63e-15 79 34 7 203 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain UTI89 / UPEC)
A1A9B7 2.63e-15 79 34 7 203 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Escherichia coli O1:K1 / APEC
Q0TJH0 2.68e-15 78 34 7 203 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q3Z3Q4 2.78e-15 78 34 7 203 3 macB Macrolide export ATP-binding/permease protein MacB Shigella sonnei (strain Ss046)
Q92NU9 2.81e-15 78 32 7 202 3 macB Macrolide export ATP-binding/permease protein MacB Rhizobium meliloti (strain 1021)
Q4K9A4 2.96e-15 78 34 9 212 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P27675 3.02e-15 76 27 6 222 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
Q6FYL0 3.17e-15 78 33 7 206 3 macB Macrolide export ATP-binding/permease protein MacB Bartonella quintana (strain Toulouse)
P72479 3.2e-15 77 26 6 236 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P0A2V2 3.33e-15 76 29 7 235 2 occP Octopine permease ATP-binding protein P Rhizobium radiobacter
P0A2V3 3.33e-15 76 29 7 235 3 occP Octopine permease ATP-binding protein P Agrobacterium tumefaciens (strain Ach5)
Q6G9I0 3.83e-15 76 25 7 225 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MSSA476)
Q5HG40 3.83e-15 76 25 7 225 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain COL)
Q2FYQ7 3.83e-15 76 25 7 225 1 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH57 3.83e-15 76 25 7 225 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain USA300)
P45094 3.96e-15 77 25 5 232 3 dppF Dipeptide transport ATP-binding protein DppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q88F88 4.03e-15 78 33 9 214 1 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q4QP85 4.07e-15 77 32 6 218 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Haemophilus influenzae (strain 86-028NP)
Q3ATR5 4.15e-15 78 31 10 234 3 macB Macrolide export ATP-binding/permease protein MacB Chlorobium chlorochromatii (strain CaD3)
Q737I0 4.57e-15 78 27 7 230 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q737I0 1.49e-07 55 28 7 188 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q2RS22 5.55e-15 76 33 7 213 3 nikE Nickel import ATP-binding protein NikE Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8NWT5 5.78e-15 75 25 7 225 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MW2)
P54537 6.1e-15 75 26 7 235 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
P72297 6.18e-15 75 28 8 248 3 occP Octopine permease ATP-binding protein P Rhizobium meliloti
Q035B2 6.64e-15 75 29 8 273 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A2RI78 6.81e-15 76 26 6 253 1 dppF Dipeptide transport ATP-binding protein DppF Lactococcus lactis subsp. cremoris (strain MG1363)
A0L0V9 7.01e-15 77 33 9 206 3 macB Macrolide export ATP-binding/permease protein MacB Shewanella sp. (strain ANA-3)
Q8FVM9 7.69e-15 75 30 6 232 2 nikD Nickel import ATP-binding protein NikD Brucella suis biovar 1 (strain 1330)
Q323M3 7.74e-15 77 34 7 203 3 macB Macrolide export ATP-binding/permease protein MacB Shigella boydii serotype 4 (strain Sb227)
Q58967 7.86e-15 75 30 6 213 3 MJ1572 Putative ABC transporter ATP-binding protein MJ1572 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q2RS21 7.98e-15 75 33 9 223 3 nikD Nickel import ATP-binding protein NikD Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8RQL7 8e-15 75 31 6 208 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q03PY5 8.61e-15 75 30 9 243 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q1JNE0 8.82e-15 76 26 9 287 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDG6 8.82e-15 76 26 9 287 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS2096)
C0SP98 8.87e-15 76 27 6 245 3 ykfD Putative oligopeptide transport ATP-binding protein YkfD Bacillus subtilis (strain 168)
A0A0H2ZH52 9.04e-15 76 27 6 233 1 dppF Di/tripeptide transport ATP-binding protein DppF Pseudomonas aeruginosa (strain UCBPP-PA14)
A1BE50 9.83e-15 77 33 9 206 3 macB Macrolide export ATP-binding/permease protein MacB Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q2FRT7 1.02e-14 76 31 9 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q2RU16 1.06e-14 74 34 10 228 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q5XDS8 1.11e-14 76 26 9 287 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P36636 1.12e-14 75 28 7 248 2 sapD Peptide transport system ATP-binding protein SapD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q0ASQ1 1.29e-14 75 33 7 211 3 phnC Phosphonates import ATP-binding protein PhnC Maricaulis maris (strain MCS10)
A0KGB3 1.34e-14 76 34 9 222 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q2KVS6 1.38e-14 76 35 7 202 3 macB Macrolide export ATP-binding/permease protein MacB Bordetella avium (strain 197N)
Q8YCN8 1.43e-14 74 30 6 232 3 nikD Nickel import ATP-binding protein NikD Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S8 1.43e-14 74 30 6 232 3 nikD Nickel import ATP-binding protein NikD Brucella abortus biovar 1 (strain 9-941)
Q2YL70 1.43e-14 74 30 6 232 3 nikD Nickel import ATP-binding protein NikD Brucella abortus (strain 2308)
Q57R58 1.52e-14 76 35 8 205 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella choleraesuis (strain SC-B67)
Q83F44 1.65e-14 75 31 8 221 3 metN Methionine import ATP-binding protein MetN Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q8Z824 1.7e-14 76 35 8 205 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhi
Q8ZQE4 1.72e-14 76 35 8 205 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PGK9 1.75e-14 76 35 8 205 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q3ICT8 2.03e-14 74 31 7 215 3 hmuV Hemin import ATP-binding protein HmuV Pseudoalteromonas translucida (strain TAC 125)
Q8P2K6 2.04e-14 75 26 9 287 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q7N6F9 2.05e-14 76 31 6 223 3 macB Macrolide export ATP-binding/permease protein MacB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P0A2V5 2.14e-14 75 25 5 229 3 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. cremoris (strain SK11)
P0A2V4 2.14e-14 75 25 5 229 1 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. lactis (strain IL1403)
Q2SMN9 2.26e-14 75 33 8 207 3 macB Macrolide export ATP-binding/permease protein MacB Hahella chejuensis (strain KCTC 2396)
P0AAH7 2.34e-14 75 28 7 248 3 sapD Peptide transport system ATP-binding protein SapD Shigella flexneri
P0AAH4 2.34e-14 75 28 7 248 1 sapD Putrescine export system ATP-binding protein SapD Escherichia coli (strain K12)
P0AAH5 2.34e-14 75 28 7 248 3 sapD Peptide transport system ATP-binding protein SapD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAH6 2.34e-14 75 28 7 248 3 sapD Peptide transport system ATP-binding protein SapD Escherichia coli O157:H7
Q1R5D8 2.4e-14 74 31 4 216 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain UTI89 / UPEC)
Q8FCM9 2.4e-14 74 31 4 216 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBX8 2.4e-14 74 31 4 216 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q7NUJ3 2.68e-14 75 34 7 202 3 macB Macrolide export ATP-binding/permease protein MacB Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q31VE6 2.71e-14 73 31 4 216 3 nikE Nickel import ATP-binding protein NikE Shigella boydii serotype 4 (strain Sb227)
Q8XXB6 3.34e-14 75 33 9 226 3 msbA ATP-dependent lipid A-core flippase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8FV85 4.03e-14 74 30 8 242 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 4.03e-14 74 30 8 242 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 4.03e-14 74 30 8 242 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 4.03e-14 74 30 8 242 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
O34697 4.26e-14 73 31 9 216 1 bceA Bacitracin export ATP-binding protein BceA Bacillus subtilis (strain 168)
Q48V78 4.33e-14 74 26 9 287 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A1E3 4.33e-14 74 26 9 287 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
Q7VZ31 4.46e-14 72 36 8 211 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W8T0 4.46e-14 72 36 8 211 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WK40 4.46e-14 72 36 8 211 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q82VL9 4.65e-14 72 33 7 217 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q74L62 4.72e-14 73 28 7 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q03Z27 4.9e-14 74 27 10 241 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q81IZ6 4.95e-14 74 29 8 225 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5YRD1 5.33e-14 73 30 8 223 3 metN Methionine import ATP-binding protein MetN Nocardia farcinica (strain IFM 10152)
Q89NX6 5.59e-14 74 33 7 207 3 macB Macrolide export ATP-binding/permease protein MacB Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5P6D5 5.66e-14 74 33 8 212 3 macB Macrolide export ATP-binding/permease protein MacB Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q07LU3 5.77e-14 73 32 5 207 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisA53)
Q32AQ1 5.8e-14 73 31 4 216 3 nikE Nickel import ATP-binding protein NikE Shigella dysenteriae serotype 1 (strain Sd197)
Q2RPB4 5.85e-14 74 34 8 206 3 macB Macrolide export ATP-binding/permease protein MacB Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P37313 5.87e-14 73 25 6 255 1 dppF Dipeptide transport ATP-binding protein DppF Escherichia coli (strain K12)
P42065 6.06e-14 73 24 6 258 3 appF Oligopeptide transport ATP-binding protein AppF Bacillus subtilis (strain 168)
P14788 6.4e-14 73 29 8 245 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8X4L6 6.47e-14 73 31 4 216 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O157:H7
Q3KF57 6.51e-14 74 33 9 222 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas fluorescens (strain Pf0-1)
Q88XV2 7.13e-14 73 30 8 226 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q81PZ8 7.24e-14 74 27 9 241 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q81PZ8 2.37e-06 52 29 5 177 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
A0KMJ3 7.45e-14 74 31 8 219 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q9K619 7.89e-14 72 30 9 218 3 bceA Bacitracin export ATP-binding protein BceA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P48243 8.13e-14 72 27 5 223 1 gluA Glutamate transport ATP-binding protein GluA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q73F11 9.07e-14 73 29 8 225 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q63H29 9.42e-14 73 30 8 225 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
P33594 9.79e-14 72 31 4 216 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain K12)
Q3YW48 9.89e-14 72 31 4 216 3 nikE Nickel import ATP-binding protein NikE Shigella sonnei (strain Ss046)
Q7VMF9 9.94e-14 74 33 8 210 3 macB Macrolide export ATP-binding/permease protein MacB Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6HI76 1e-13 73 27 9 241 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HI76 2.03e-06 52 29 5 177 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q4KC87 1.01e-13 73 35 7 205 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6GH28 1.02e-13 72 25 4 235 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MRSA252)
Q972J5 1.08e-13 73 29 8 204 3 STK_11360 Putative ABC transporter ATP-binding protein STK_11360 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q2KVK2 1.12e-13 73 32 8 215 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q3AKM8 1.18e-13 72 31 10 258 3 phnC Phosphonates import ATP-binding protein PhnC Synechococcus sp. (strain CC9605)
Q81VM2 1.2e-13 73 30 8 225 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q2EHL8 1.22e-13 73 30 8 213 1 macB Macrolide export ATP-binding/permease protein MacB Aggregatibacter actinomycetemcomitans
Q21NS8 1.3e-13 73 31 10 228 3 msbA ATP-dependent lipid A-core flippase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q39GT7 1.54e-13 72 29 6 228 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q4ZT65 1.8e-13 73 33 8 204 3 syfD Probable syringafactin export ATP-binding/permease protein SyfD Pseudomonas syringae pv. syringae (strain B728a)
Q1J8E4 1.95e-13 72 26 10 288 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1BJA5 1.97e-13 71 31 10 234 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia orbicola (strain AU 1054)
A0B3E2 1.97e-13 71 31 10 234 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia cenocepacia (strain HI2424)
Q2NIT5 2.02e-13 71 29 8 218 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Aster yellows witches'-broom phytoplasma (strain AYWB)
Q3SQZ1 2.04e-13 73 32 8 205 3 macB Macrolide export ATP-binding/permease protein MacB Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q7MLB8 2.21e-13 72 30 7 240 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Vibrio vulnificus (strain YJ016)
Q0A4U4 2.22e-13 73 32 9 246 3 msbA ATP-dependent lipid A-core flippase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q8D954 2.32e-13 72 31 7 235 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Vibrio vulnificus (strain CMCP6)
Q138A9 2.39e-13 71 32 8 226 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB5)
P08007 2.47e-13 72 26 8 245 1 oppF Oligopeptide transport ATP-binding protein OppF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q4L8L7 2.64e-13 70 32 8 206 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus haemolyticus (strain JCSC1435)
P72335 2.71e-13 71 30 7 220 3 nodI Nod factor export ATP-binding protein I Rhizobium sp. (strain N33)
Q92LU2 2.93e-13 72 31 7 206 3 modC Molybdenum import ATP-binding protein ModC Rhizobium meliloti (strain 1021)
Q2SB47 3e-13 70 33 8 220 3 hmuV Hemin import ATP-binding protein HmuV Hahella chejuensis (strain KCTC 2396)
Q5FKL2 3.68e-13 71 27 10 238 3 metN Methionine import ATP-binding protein MetN Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q0SZJ3 3.96e-13 70 30 4 216 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri serotype 5b (strain 8401)
Q0B697 4.31e-13 70 32 11 234 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
P47705 4.4e-13 71 27 4 204 3 MG467 Putative ABC transporter ATP-binding protein MG467 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q399M3 4.41e-13 72 33 7 203 3 macB Macrolide export ATP-binding/permease protein MacB Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q65P77 4.46e-13 70 32 8 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q83J77 4.73e-13 70 30 4 216 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri
Q8FRX8 4.91e-13 71 30 7 207 3 metN Methionine import ATP-binding protein MetN Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q88HL0 4.99e-13 70 31 7 221 3 nikE Nickel import ATP-binding protein NikE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P77737 5.03e-13 71 25 6 244 1 oppF Oligopeptide transport ATP-binding protein OppF Escherichia coli (strain K12)
Q63TX3 5.2e-13 70 30 7 220 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain K96243)
Q3JSQ0 5.84e-13 70 30 7 220 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain 1710b)
Q62K72 5.84e-13 70 30 7 220 3 nodI Nod factor export ATP-binding protein I Burkholderia mallei (strain ATCC 23344)
A1VYW8 6.36e-13 71 29 7 214 3 macB Macrolide export ATP-binding/permease protein MacB Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q48KB2 6.47e-13 71 33 8 205 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q6YRJ4 6.68e-13 71 28 9 222 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q47JR8 7.11e-13 71 32 9 244 3 msbA ATP-dependent lipid A-core flippase Dechloromonas aromatica (strain RCB)
Q5HG41 7.12e-13 69 24 4 235 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain COL)
Q2FYQ8 7.12e-13 69 24 4 235 1 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH58 7.12e-13 69 24 4 235 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain USA300)
F8DT93 7.38e-13 69 33 9 213 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1)
P45769 7.43e-13 69 29 7 211 3 yhdZ Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ Escherichia coli (strain K12)
Q7A5Q9 8.26e-13 69 24 4 231 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain N315)
Q99UA3 8.26e-13 69 24 4 231 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8NWT6 8.51e-13 69 24 4 235 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MW2)
Q6G9I1 8.51e-13 69 24 4 235 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MSSA476)
Q9FUT3 8.66e-13 71 26 7 239 1 ABCB23 ABC transporter B family member 23, mitochondrial Arabidopsis thaliana
Q21BU8 8.98e-13 70 30 5 216 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB18)
Q52815 9.52e-13 69 26 5 220 3 aapP General L-amino acid transport ATP-binding protein AapP Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P0DJA1 9.55e-13 69 33 9 213 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
O31711 1.01e-12 68 30 9 220 1 yknY Uncharacterized ABC transporter ATP-binding protein YknY Bacillus subtilis (strain 168)
Q5X484 1.06e-12 70 28 9 230 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
Q92AF9 1.08e-12 69 28 5 219 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q5ZUG5 1.2e-12 70 28 9 230 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q9M0G9 1.22e-12 70 26 7 245 1 ABCB24 ABC transporter B family member 24, mitochondrial Arabidopsis thaliana
Q63VX7 1.27e-12 70 32 8 237 3 msbA ATP-dependent lipid A-core flippase Burkholderia pseudomallei (strain K96243)
Q3JUI6 1.27e-12 70 32 8 237 3 msbA ATP-dependent lipid A-core flippase Burkholderia pseudomallei (strain 1710b)
Q62IG3 1.27e-12 70 32 8 237 3 msbA ATP-dependent lipid A-core flippase Burkholderia mallei (strain ATCC 23344)
Q5HM28 1.29e-12 69 24 6 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q08D64 1.48e-12 70 30 9 237 2 abcb6 ATP-binding cassette sub-family B member 6 Xenopus tropicalis
Q5QXD0 1.5e-12 68 28 8 244 3 hmuV Hemin import ATP-binding protein HmuV Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
P55339 1.54e-12 68 26 5 202 1 ecsA ABC-type transporter ATP-binding protein EcsA Bacillus subtilis (strain 168)
Q8KFE9 1.64e-12 70 30 8 212 3 macB Macrolide export ATP-binding/permease protein MacB Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q1QDA8 1.67e-12 70 29 7 209 3 macB Macrolide export ATP-binding/permease protein MacB Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A1K323 1.69e-12 70 33 7 203 3 macB Macrolide export ATP-binding/permease protein MacB Azoarcus sp. (strain BH72)
Q5WVL8 1.7e-12 69 28 9 230 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
Q3IWB5 1.71e-12 68 31 10 249 3 znuC Zinc import ATP-binding protein ZnuC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
O34338 1.73e-12 68 30 7 212 2 mntB Manganese transport system ATP-binding protein MntB Bacillus subtilis (strain 168)
O31339 1.86e-12 69 27 8 259 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q0PAR0 1.89e-12 70 29 7 214 3 macB Macrolide export ATP-binding/permease protein MacB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q217B2 1.92e-12 68 31 7 218 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB18)
Q2SZW0 2.04e-12 70 30 7 230 3 msbA ATP-dependent lipid A-core flippase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q884D4 2.06e-12 70 33 8 206 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1WVG9 2.14e-12 69 25 6 233 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
Q5HVG3 2.18e-12 70 29 7 214 3 macB Macrolide export ATP-binding/permease protein MacB Campylobacter jejuni (strain RM1221)
Q4FU75 2.29e-12 70 29 7 209 3 macB Macrolide export ATP-binding/permease protein MacB Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q7CJG3 2.3e-12 70 33 7 203 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis
Q1C5W7 2.3e-12 70 33 7 203 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q1CJW8 2.3e-12 70 33 7 203 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis bv. Antiqua (strain Nepal516)
A0B212 2.31e-12 70 33 7 203 3 macB Macrolide export ATP-binding/permease protein MacB Burkholderia cenocepacia (strain HI2424)
Q668L6 2.33e-12 70 33 7 203 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q5E5I1 2.38e-12 68 28 10 250 3 hmuV Hemin import ATP-binding protein HmuV Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q1WSB9 2.4e-12 68 28 6 234 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q8KLG1 2.42e-12 68 28 6 221 3 nodI Nod factor export ATP-binding protein I Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q6D8T5 2.49e-12 70 33 8 203 3 macB Macrolide export ATP-binding/permease protein MacB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P74548 2.57e-12 69 29 7 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q88HL1 2.61e-12 68 31 7 241 3 nikD Nickel import ATP-binding protein NikD Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8YUI9 2.62e-12 68 33 6 208 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8YA75 2.69e-12 69 31 9 209 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q1I966 2.73e-12 69 34 9 202 3 macB Probable export ATP-binding/permease protein MacB Pseudomonas entomophila (strain L48)
Q2YXZ0 2.77e-12 67 24 4 235 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q04DA7 2.84e-12 69 26 8 242 3 metN2 Methionine import ATP-binding protein MetN 2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q6LQC0 2.84e-12 68 29 10 229 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium profundum (strain SS9)
Q4UMZ7 2.91e-12 67 31 11 216 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q8E3S6 2.93e-12 69 24 4 204 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q1BPZ6 2.99e-12 69 33 7 203 3 macB Macrolide export ATP-binding/permease protein MacB Burkholderia orbicola (strain AU 1054)
Q7VV72 3.08e-12 69 31 8 210 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4E1 3.08e-12 69 31 8 210 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFU9 3.08e-12 69 31 8 210 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8ELA5 3.1e-12 68 30 11 228 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q03EE4 3.13e-12 68 26 8 242 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A0A0H2ZLL3 3.17e-12 67 28 6 228 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8YCN7 3.18e-12 68 30 7 218 3 nikE Nickel import ATP-binding protein NikE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S7 3.18e-12 68 30 7 218 3 nikE Nickel import ATP-binding protein NikE Brucella abortus biovar 1 (strain 9-941)
Q2YL69 3.18e-12 68 30 7 218 3 nikE Nickel import ATP-binding protein NikE Brucella abortus (strain 2308)
Q7NN36 3.23e-12 68 31 7 214 3 hmuV Hemin import ATP-binding protein HmuV Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
O34392 3.45e-12 67 30 9 227 2 ytrE ABC transporter ATP-binding protein YtrE Bacillus subtilis (strain 168)
Q81GU1 3.48e-12 68 27 8 259 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2SVP3 3.62e-12 68 30 7 220 3 nodI Nod factor export ATP-binding protein I Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q9HPH7 3.75e-12 67 28 6 206 3 VNG_1631G Putative ABC transporter ATP-binding protein VNG_1631G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q49ZT6 4.01e-12 67 31 8 216 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q045Z8 4.1e-12 68 29 8 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q6YR39 4.11e-12 68 29 7 210 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Onion yellows phytoplasma (strain OY-M)
Q8DY60 4.13e-12 69 24 4 204 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3MGT2 4.24e-12 67 33 6 208 3 phnC Phosphonates import ATP-binding protein PhnC Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8FVN0 4.57e-12 67 30 7 218 2 nikE Nickel import ATP-binding protein NikE Brucella suis biovar 1 (strain 1330)
Q67JX4 4.64e-12 68 29 5 204 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P47425 4.76e-12 67 26 6 208 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P14175 4.83e-12 68 26 7 231 1 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Escherichia coli (strain K12)
P17328 4.87e-12 68 27 7 231 2 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q0A8P9 4.91e-12 67 34 6 203 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q4KES7 4.92e-12 68 34 9 202 3 PFL_2149 Probable export ATP-binding/permease protein PFL_2149 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9I6L0 4.94e-12 68 30 7 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9LVM1 4.96e-12 68 27 7 245 1 ABCB25 ABC transporter B family member 25, mitochondrial Arabidopsis thaliana
Q724C0 5.15e-12 68 31 9 209 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
O34900 5.41e-12 67 26 9 242 1 tcyN L-cystine import ATP-binding protein TcyN Bacillus subtilis (strain 168)
Q46Y89 5.49e-12 68 32 8 228 3 msbA ATP-dependent lipid A-core flippase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q70GD4 5.66e-12 67 30 9 246 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damsela subsp. piscicida
Q8XK20 5.76e-12 68 24 6 233 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 1.91e-05 49 24 11 266 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8U4L3 5.86e-12 67 29 8 217 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
A1B677 5.87e-12 68 33 8 204 3 macB1 Macrolide export ATP-binding/permease protein MacB 1/2 Paracoccus denitrificans (strain Pd 1222)
Q2G7G7 6.01e-12 67 32 9 211 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q8DWR3 6.43e-12 67 28 7 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L2 6.43e-12 67 28 7 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF4 6.43e-12 67 28 7 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q9KRT4 6.5e-12 68 30 7 233 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7NAQ6 6.75e-12 67 25 7 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
O27739 6.78e-12 67 28 5 210 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q6LX68 6.82e-12 67 26 7 205 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q88AS5 6.98e-12 67 30 7 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q6LQ00 7.05e-12 68 28 8 235 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q6LQ00 0.000194 46 25 10 240 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
P45092 7.27e-12 67 29 5 210 3 artP Arginine transport ATP-binding protein ArtP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45022 7.38e-12 67 28 7 221 3 HI_1078 Probable amino-acid ABC transporter ATP-binding protein HI_1078 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4ZV10 7.49e-12 68 32 8 206 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas syringae pv. syringae (strain B728a)
Q5QU46 7.51e-12 66 33 8 211 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q50294 7.52e-12 67 29 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q1RK34 7.6e-12 66 30 8 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rickettsia bellii (strain RML369-C)
Q8RI39 7.67e-12 68 27 7 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q881Q1 8.05e-12 68 31 9 223 2 syfD Probable syringafactin export ATP-binding/permease protein SyfD Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q31J97 8.07e-12 67 29 8 214 3 hmuV Hemin import ATP-binding protein HmuV Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q1CI46 8.14e-12 66 31 9 228 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFR4 8.14e-12 66 31 9 228 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis
Q1C6Q8 8.14e-12 66 31 9 228 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Antiqua)
Q1BWI2 8.2e-12 67 29 7 235 3 nodI Nod factor export ATP-binding protein I Burkholderia orbicola (strain AU 1054)
Q8CRI7 8.3e-12 67 23 6 217 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q65TH4 8.39e-12 68 30 9 204 3 macB Macrolide export ATP-binding/permease protein MacB Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q97X60 8.64e-12 68 27 7 244 3 SSO1893 Putative ABC transporter ATP-binding protein SSO1893 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q97X60 2.87e-08 57 22 6 265 3 SSO1893 Putative ABC transporter ATP-binding protein SSO1893 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P0A9U0 8.71e-12 66 33 9 230 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Shigella flexneri
P0A9T8 8.71e-12 66 33 9 230 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Escherichia coli (strain K12)
P0A9T9 8.71e-12 66 33 9 230 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Escherichia coli O157:H7
P77622 8.86e-12 67 26 6 230 2 ddpF Probable D,D-dipeptide transport ATP-binding protein DdpF Escherichia coli (strain K12)
Q8CRB0 8.94e-12 66 30 10 223 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q2NSZ1 9.7e-12 68 32 5 225 3 macB Macrolide export ATP-binding/permease protein MacB Sodalis glossinidius (strain morsitans)
Q5HLN4 9.97e-12 66 30 10 223 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q669P3 1.03e-11 66 31 9 229 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pseudotuberculosis serotype I (strain IP32953)
Q3KE48 1.11e-11 68 34 9 202 3 Pfl01_2215 Probable export ATP-binding/permease protein Pfl01_2215 Pseudomonas fluorescens (strain Pf0-1)
P9WQK1 1.18e-11 66 30 8 224 1 Rv0986 Uncharacterized ABC transporter ATP-binding protein Rv0986 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQK0 1.18e-11 66 30 8 224 3 MT1014 Uncharacterized ABC transporter ATP-binding protein MT1014 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q2W450 1.23e-11 65 31 11 235 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q254K9 1.29e-11 67 27 7 217 3 metN Methionine import ATP-binding protein MetN Chlamydia felis (strain Fe/C-56)
Q8NQU4 1.3e-11 66 36 1 109 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q882S0 1.33e-11 66 29 8 238 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q92EZ6 1.38e-11 67 31 9 209 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8FVT0 1.42e-11 67 31 12 241 3 BRA0745 Putative ATP-binding protein BRA0745/BS1330_II0738 Brucella suis biovar 1 (strain 1330)
Q93SS1 1.57e-11 66 29 6 240 3 hmuV Hemin import ATP-binding protein HmuV Plesiomonas shigelloides
Q2YKZ7 1.58e-11 67 31 12 241 3 BAB2_0493 Putative ATP-binding protein BAB2_0493 Brucella abortus (strain 2308)
Q578M5 1.58e-11 67 31 12 241 3 BruAb2_0487 Putative ATP-binding protein BruAb2_0487 Brucella abortus biovar 1 (strain 9-941)
G5EFD4 1.59e-11 67 28 7 235 2 hmt-1 Heavy metal tolerance factor 1 Caenorhabditis elegans
Q8Y651 1.63e-11 65 27 5 219 3 mntB Manganese transport system ATP-binding protein MntB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q492R2 1.63e-11 65 29 8 219 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Blochmanniella pennsylvanica (strain BPEN)
Q8PYH5 1.65e-11 66 28 7 219 3 MM_0887 Putative ABC transporter ATP-binding protein MM_0887 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q48QM2 1.81e-11 66 28 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 1.81e-11 66 28 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0C0E8 1.81e-11 66 28 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
Q8R7Y5 1.83e-11 66 27 6 208 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P0C0E9 1.86e-11 66 28 10 240 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 1.86e-11 66 28 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 1.86e-11 66 28 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 1.86e-11 66 28 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 1.86e-11 66 28 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7CMM7 1.86e-11 66 28 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 1.86e-11 66 28 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 1.86e-11 66 28 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q10418 1.89e-11 67 27 8 234 3 mesD Mesentericin-Y105 transport/processing ATP-binding protein MesD Leuconostoc mesenteroides
Q48HL2 2.04e-11 66 30 7 212 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
O26236 2.07e-11 66 28 6 214 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q0C1N8 2.19e-11 67 32 9 215 3 macB Macrolide export ATP-binding/permease protein MacB Hyphomonas neptunium (strain ATCC 15444)
Q38UT9 2.3e-11 65 28 7 219 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q823C4 2.32e-11 66 27 7 237 3 metN Methionine import ATP-binding protein MetN Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q98L75 2.36e-11 65 27 11 243 3 hmuV Hemin import ATP-binding protein HmuV Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A0A348AXX9 2.48e-11 67 29 7 243 2 kk1G ABC-type transporter kk1G Curvularia clavata
Q667L9 2.62e-11 66 28 7 232 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
A1B9H9 2.75e-11 65 32 5 208 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Paracoccus denitrificans (strain Pd 1222)
Q6F813 2.76e-11 67 33 8 206 3 macB Macrolide export ATP-binding/permease protein MacB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q92GP5 2.83e-11 65 30 10 214 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P35116 2.92e-11 65 25 5 241 3 nocP Nopaline permease ATP-binding protein P Agrobacterium fabrum (strain C58 / ATCC 33970)
Q659V4 3.04e-11 65 30 9 246 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damselae subsp. damselae
Q2M3G0 3.1e-11 67 31 9 222 1 ABCB5 ATP-binding cassette sub-family B member 5 Homo sapiens
Q2M3G0 5.8e-07 53 27 8 225 1 ABCB5 ATP-binding cassette sub-family B member 5 Homo sapiens
Q53194 3.33e-11 66 28 6 232 3 NGR_a01400 Probable peptide ABC transporter ATP-binding protein y4tS Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q1J982 3.36e-11 65 27 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q6D2F6 3.36e-11 65 32 9 222 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5M5Z2 3.39e-11 65 26 12 283 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
E0SCY1 3.42e-11 66 26 6 227 1 ousV Glycine betaine/choline transport system ATP-binding protein OusV Dickeya dadantii (strain 3937)
Q0APW8 3.43e-11 64 31 10 229 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Maricaulis maris (strain MCS10)
Q7NZU6 3.6e-11 66 31 8 241 3 msbA ATP-dependent lipid A-core flippase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P16678 3.63e-11 65 28 7 230 1 phnK Putative phosphonates utilization ATP-binding protein PhnK Escherichia coli (strain K12)
Q4QK57 3.74e-11 65 30 6 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
O34977 3.79e-11 64 26 8 252 3 ythP Uncharacterized ABC transporter ATP-binding protein YthP Bacillus subtilis (strain 168)
Q9A9P4 3.92e-11 64 35 9 202 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q2L219 3.95e-11 64 32 8 213 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella avium (strain 197N)
Q58488 4.15e-11 65 24 7 230 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q7VR29 4.21e-11 64 26 8 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Blochmanniella floridana
Q8DRR9 4.23e-11 65 25 8 252 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q3K6R9 4.34e-11 64 32 7 228 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain Pf0-1)
O34756 4.36e-11 64 30 10 218 3 yjkB Putative ABC transporter ATP-binding protein YjkB Bacillus subtilis (strain 168)
Q9DC29 4.38e-11 66 28 8 243 1 Abcb6 ATP-binding cassette sub-family B member 6 Mus musculus
Q48GY7 4.5e-11 66 26 7 210 3 PSPPH_3184 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48GY7 2.95e-05 48 20 4 207 3 PSPPH_3184 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A3CRB9 4.62e-11 65 29 7 220 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus sanguinis (strain SK36)
Q8XXY9 4.64e-11 65 27 7 250 3 nodI Nod factor export ATP-binding protein I Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9YGA6 4.82e-11 65 30 9 242 1 malK Trehalose/maltose import ATP-binding protein MalK Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
H2LNR5 4.95e-11 66 28 9 251 1 abcb7 Iron-sulfur clusters transporter ABCB7, mitochondrial Oryzias latipes
P36497 5.24e-11 66 28 8 224 3 pedD Pediocin PA-1 transport/processing ATP-binding protein PedD Pediococcus acidilactici
Q04BY6 5.32e-11 65 28 7 256 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBI9 5.32e-11 65 28 7 256 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
P34713 5.51e-11 66 29 11 246 2 pgp-3 Multidrug resistance protein pgp-3 Caenorhabditis elegans
P34713 5.86e-07 53 28 10 239 2 pgp-3 Multidrug resistance protein pgp-3 Caenorhabditis elegans
Q5H0G3 5.68e-11 64 31 6 217 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P3E1 5.68e-11 64 31 6 217 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q897I2 5.69e-11 65 23 7 225 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
P54954 5.72e-11 64 28 8 223 1 yxeO Probable amino-acid import ATP-binding protein YxeO Bacillus subtilis (strain 168)
P49938 6.1e-11 64 28 8 211 3 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Bacillus subtilis (strain 168)
A1U0A9 6.18e-11 65 32 7 201 3 macB Macrolide export ATP-binding/permease protein MacB Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q97KD5 6.43e-11 65 27 6 241 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8EPK1 6.46e-11 65 29 8 220 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P26050 6.63e-11 64 29 5 200 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q6D201 6.84e-11 65 28 7 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2SIN5 7.1e-11 65 29 7 225 3 msbA ATP-dependent lipid A-core flippase Hahella chejuensis (strain KCTC 2396)
Q9NP58 7.15e-11 65 27 9 254 1 ABCB6 ATP-binding cassette sub-family B member 6 Homo sapiens
Q8ELQ6 7.2e-11 65 28 8 217 3 metN3 Methionine import ATP-binding protein MetN 3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q52666 7.2e-11 64 26 7 231 3 bztD Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O34510 7.41e-11 64 27 7 229 3 yfmF Fe(3+)-citrate import ATP-binding protein YfmF Bacillus subtilis (strain 168)
A0A125QXJ1 7.49e-11 65 29 7 223 2 ABCB6 ATP-binding cassette sub-family B member 6 Mesocricetus auratus
Q63MM6 7.68e-11 65 32 7 202 3 macB Macrolide export ATP-binding/permease protein MacB Burkholderia pseudomallei (strain K96243)
Q3JGG7 7.68e-11 65 32 7 202 3 macB Macrolide export ATP-binding/permease protein MacB Burkholderia pseudomallei (strain 1710b)
Q8Y0C6 7.69e-11 63 32 8 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q4ZU82 7.85e-11 64 30 7 212 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. syringae (strain B728a)
Q88CL2 7.99e-11 64 29 9 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9CK97 8.48e-11 64 28 6 209 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
Q5WUF8 8.67e-11 63 31 7 206 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Lens)
Q9X051 8.67e-11 65 26 5 207 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9X051 4.53e-07 53 23 4 233 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P94420 9.51e-11 63 25 7 206 1 yclP Petrobactin import ATP-binding protein YclP Bacillus subtilis (strain 168)
Q6N798 9.97e-11 64 28 7 258 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q5FM63 1.02e-10 64 28 6 222 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q0S0Z3 1.08e-10 64 32 9 221 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhodococcus jostii (strain RHA1)
Q50801 1.12e-10 63 27 6 211 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q28QL7 1.17e-10 64 29 7 227 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Jannaschia sp. (strain CCS1)
Q8TIX0 1.27e-10 64 28 6 208 3 MA_4020 Putative ABC transporter ATP-binding protein MA_4020 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8DIA0 1.29e-10 64 28 7 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q57554 1.36e-10 63 26 8 226 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q92N13 1.4e-10 63 29 9 228 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium meliloti (strain 1021)
Q74I62 1.45e-10 64 24 7 253 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q74I62 9.81e-06 50 24 5 221 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q9KHT9 1.45e-10 64 25 7 224 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes
G2JZ44 1.45e-10 64 25 7 224 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes serotype 1/2a (strain 10403S)
P15031 1.46e-10 63 30 6 205 1 fecE Fe(3+) dicitrate transport ATP-binding protein FecE Escherichia coli (strain K12)
P45171 1.47e-10 64 29 6 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_09720
Feature type CDS
Gene gsiA
Product ABC-type glutathione transport system ATPase component, contains duplicated ATPase domain
Location 174818 - 175615 (strand: -1)
Length 798 (nucleotides) / 265 (amino acids)
In genomic island -

Contig

Accession ZDB_218
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1223
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1123 Posttranslational modification, protein turnover, chaperones (O) O ABC-type glutathione transport system ATPase component, contains duplicated ATPase domain

Protein Sequence

MLKFDRLAIDVAQFSWLRKKRWQPLLTDISLAVQPGELVALVGSSGEGKSLLLQSALGLLPDNMRCRGAISLAGETLTEESKQLHRGNTLCYVPQGVSALNPLVRVGPQLERAATLSGMHVKMHDVARQLQRYNLRPELTDAFPNRLSGGMAKRVLTCGATLTGAQYILADEITSWLDDEHAGQILAHLKVLCADGRGVLWVTHDLAMAARFADRIAVLRHGVLQETLTSQALLNGEGSPWLQSLWDALPEHRFLAGRKYTGMRR

Flanking regions ( +/- flanking 50bp)

TTTGATCAGTTTGCGAAAGCCTTACAACAGCTCTGGCTGAGGATCGCATAATGCTGAAATTTGACCGGCTTGCCATTGATGTCGCACAGTTCAGCTGGCTGCGGAAAAAACGCTGGCAGCCGCTGCTGACAGATATCTCCCTGGCAGTTCAGCCCGGTGAGCTGGTGGCGCTGGTCGGCAGCAGCGGGGAAGGCAAAAGCCTGCTGCTGCAAAGTGCACTGGGGCTTCTGCCGGATAATATGCGCTGCCGTGGCGCTATCTCGCTGGCGGGGGAAACCCTGACGGAAGAGAGTAAACAACTGCACCGCGGCAACACCCTGTGTTACGTACCGCAGGGGGTGAGTGCGCTGAATCCGCTGGTGCGGGTCGGCCCGCAGCTGGAACGCGCGGCCACACTCAGCGGTATGCATGTGAAGATGCACGACGTGGCGCGCCAGCTGCAACGTTATAACCTCCGGCCTGAGCTGACGGATGCGTTTCCGAACCGGCTCTCCGGCGGGATGGCAAAACGGGTGCTGACCTGCGGCGCAACGCTGACCGGGGCGCAGTATATTCTGGCGGATGAAATTACGTCCTGGCTGGATGACGAACATGCGGGGCAGATACTCGCGCATCTGAAAGTGCTGTGTGCGGACGGGCGCGGTGTGTTGTGGGTCACTCATGATCTGGCGATGGCCGCCCGCTTTGCTGACCGGATTGCCGTGCTGCGTCACGGGGTTTTACAGGAAACACTGACATCGCAGGCATTACTGAACGGGGAAGGCAGCCCGTGGCTGCAGTCACTGTGGGACGCACTGCCGGAACACCGTTTTCTGGCGGGGCGGAAATATACCGGGATGAGGCGGTAATAAGAATGACGGATGAATACAGGTGATAATCCGCTTTAATTCGTCCGTAT