Homologs in group_3006

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17655 FBDBKF_17655 90.2 Morganella morganii S1 potC ABC-type spermidine/putrescine transport system, permease component II
EHELCC_18140 EHELCC_18140 90.2 Morganella morganii S2 potC ABC-type spermidine/putrescine transport system, permease component II
NLDBIP_18010 NLDBIP_18010 90.2 Morganella morganii S4 potC ABC-type spermidine/putrescine transport system, permease component II
LHKJJB_18205 LHKJJB_18205 90.2 Morganella morganii S3 potC ABC-type spermidine/putrescine transport system, permease component II
HKOGLL_17995 HKOGLL_17995 90.2 Morganella morganii S5 potC ABC-type spermidine/putrescine transport system, permease component II

Distribution of the homologs in the orthogroup group_3006

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3006

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8Z8X0 5.31e-09 58 24 4 243 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella typhi
Q5PFQ5 2.44e-08 57 23 4 243 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P96065 3.73e-08 56 27 3 169 2 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57SD8 5.97e-08 55 27 3 169 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella choleraesuis (strain SC-B67)
P18795 8.16e-07 52 25 8 207 3 nifC Probable transport system permease protein NifC Clostridium pasteurianum
P55452 1.08e-06 53 26 6 250 3 NGR_a03680 Probable ABC transporter permease protein y4fN Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0AFK6 2.36e-06 51 23 5 230 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli (strain K12)
P0AFK7 2.36e-06 51 23 5 230 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFK8 2.36e-06 51 23 5 230 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli O157:H7
Q83RR7 2.56e-06 51 23 5 230 3 potC Spermidine/putrescine transport system permease protein PotC Shigella flexneri
P37731 5.82e-06 49 28 8 216 3 modB Molybdenum transport system permease protein ModB Azotobacter vinelandii
Q6QJE2 1.21e-05 49 26 6 193 1 SULP2 Sulfate permease 2, chloroplastic Chlamydomonas reinhardtii
P31135 1.89e-05 48 26 5 201 1 potH Putrescine transport system permease protein PotH Escherichia coli (strain K12)
P27370 2.01e-05 48 23 11 263 2 cysW Sulfate transport system permease protein CysW Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P26246 2.18e-05 48 27 4 162 3 cysT Probable sulfate transport system permease protein cysT Marchantia polymorpha
Q9TJR4 2.27e-05 48 24 2 161 3 cysT Probable sulfate transport system permease protein cysT Prototheca wickerhamii
P45169 4.42e-05 47 26 6 194 3 potC Spermidine/putrescine transport system permease protein PotC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O51924 5.11e-05 47 27 10 211 1 malF Trehalose/maltose transport system permease protein MalF Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
P45322 0.000306 44 29 7 177 3 modB Molybdenum transport system permease protein ModB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AEB0 0.000354 44 30 10 205 1 cysW Sulfate transport system permease protein CysW Escherichia coli (strain K12)
P0AEB1 0.000354 44 30 10 205 3 cysW Sulfate transport system permease protein CysW Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P16701 0.000491 44 26 9 192 3 cysU Sulfate transport system permease protein CysT Escherichia coli (strain K12)
Q9TKU8 0.000752 43 29 6 141 3 cysT Probable sulfate transport system permease protein cysT Nephroselmis olivacea

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS15035
Feature type CDS
Gene -
Product ABC transporter permease
Location 246292 - 247092 (strand: -1)
Length 801 (nucleotides) / 266 (amino acids)

Contig

Accession term accessions NZ_VXKB01000004 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3006
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1177 Amino acid transport and metabolism (E) E ABC-type spermidine/putrescine transport system, permease component II

Protein Sequence

MPSADLALTPPAIPRYHKIMLSIIVVMLLLPIAATLIYSFSSRWGATVLPDGLTLQWYMKLWQDPRFLAAFGRSLFICFVTLALSALVILPLVFAVFYYFPRLKGVMEILIILPFAVPPVVSSVGLLQLFADGPFPIVGTPWILIGTYFTIALPFMYRALANSLNGVPLKDLMDAAHLLGASTFKAVLLVVVPNIRKGLLVSLLIAFSFLFGEFVFANILVGTRFETLQIYLYNMRQTSGHFTSALVMSYFVFTLILTLTASRLSR

Flanking regions ( +/- flanking 50bp)

TCTTGGATTTATCACCGCAACATATCATTGGCTGCTGAAACGGAGTTACCATGCCAAGTGCTGATCTTGCCCTGACCCCACCGGCAATTCCCCGTTACCACAAAATCATGCTCAGTATCATTGTGGTTATGCTGCTGTTACCGATTGCCGCCACACTGATTTATTCATTTTCCTCCCGCTGGGGTGCGACTGTACTGCCCGACGGACTGACACTTCAGTGGTATATGAAGCTCTGGCAGGATCCGCGATTTCTTGCCGCCTTCGGGCGCTCACTGTTTATCTGCTTTGTCACCCTGGCACTCAGCGCCCTGGTGATCCTGCCGCTGGTATTTGCCGTGTTCTATTATTTCCCGCGCCTGAAAGGGGTGATGGAAATACTGATTATTCTGCCGTTCGCTGTGCCGCCGGTGGTGTCTTCAGTCGGATTACTGCAATTGTTTGCTGACGGACCTTTTCCGATTGTCGGCACACCCTGGATACTGATCGGCACCTATTTCACTATCGCGCTGCCGTTTATGTACCGGGCGCTCGCCAATAGTCTCAATGGTGTGCCGCTGAAAGATTTAATGGATGCCGCGCACCTGCTTGGCGCAAGCACCTTTAAAGCCGTTTTGCTGGTCGTGGTACCGAATATCCGCAAAGGCTTGCTGGTATCACTGCTGATCGCGTTTTCTTTTCTGTTCGGCGAATTTGTGTTTGCCAATATCCTGGTCGGTACGCGCTTTGAAACACTGCAAATTTATCTCTATAACATGCGCCAGACGAGCGGGCATTTCACCTCCGCGCTGGTAATGAGTTACTTTGTTTTCACCCTGATCCTGACACTGACAGCATCGCGTTTAAGCCGCTGAGGAACTGCTGATGAGCTATGTAATTGCTGAAAACCTGACAAAATCTTTCG