Homologs in group_1607

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10520 FBDBKF_10520 67.4 Morganella morganii S1 fimA Pilin (type 1 fimbrial protein)
EHELCC_14855 EHELCC_14855 67.4 Morganella morganii S2 fimA Pilin (type 1 fimbrial protein)
NLDBIP_14685 NLDBIP_14685 67.4 Morganella morganii S4 fimA Pilin (type 1 fimbrial protein)
LHKJJB_14660 LHKJJB_14660 67.4 Morganella morganii S3 fimA Pilin (type 1 fimbrial protein)
HKOGLL_13280 HKOGLL_13280 67.4 Morganella morganii S5 fimA Pilin (type 1 fimbrial protein)
F4V73_RS01850 F4V73_RS01850 25.6 Morganella psychrotolerans - fimbrial protein

Distribution of the homologs in the orthogroup group_1607

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1607

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P22595 1.18e-11 63 32 7 175 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
P37921 1.36e-09 58 26 8 194 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55223 3.76e-09 57 27 6 162 3 None Fimbrial subunit type 1 Salmonella typhimurium
P13429 4.06e-09 56 28 8 182 1 sfaG S-fimbrial protein subunit SfaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P37920 5.39e-08 53 27 9 194 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
Q8X5K5 1.59e-06 49 27 10 190 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P43660 3.29e-06 48 28 9 189 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P04740 6.14e-06 48 23 6 194 3 KS71A KS71A fimbrillin Escherichia coli
P37926 8.53e-06 47 25 6 157 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P04127 2.1e-05 46 24 8 200 1 papA Pap fimbrial major pilin protein Escherichia coli
P37922 6.29e-05 45 21 5 182 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P12730 0.00019 43 28 7 160 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q08456 0.000196 43 20 5 182 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P12903 0.000211 43 26 7 147 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P38052 0.000211 43 25 8 184 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P04128 0.000644 42 29 6 120 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
Q47223 0.001 41 26 7 149 1 fimA Type-1 fimbrial protein, A chain Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14230
Feature type CDS
Gene -
Product fimbrial protein
Location 63951 - 64514 (strand: -1)
Length 564 (nucleotides) / 187 (amino acids)

Contig

Accession term accessions NZ_VXKB01000004 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1607
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis		 -

Protein Sequence

MKTFLTGKTVLSILLAGSVMSASAVEQDGTISFRGFIYNATCSIDINNSNSPNADVEMGRYPTSAFTGSGDEVGGEGKNGSLDISLIDCPDQGTVQLQLHGTRKDGHESVLELDNPNDDNTAKNIGIIIYNRDNMDEPITIDGESEEYDVVSSTEWHASYVAKYTSTADDVEAGQADATLNYTLSYN

Flanking regions ( +/- flanking 50bp)

TTATTTAGCCACCCGAATACTACCGATATTAATTCAAACAAGGTTTTTTAATGAAAACGTTTTTAACAGGCAAAACTGTATTATCTATTTTATTAGCAGGTTCAGTAATGAGTGCATCCGCTGTTGAACAGGATGGCACAATCTCATTCAGAGGTTTTATTTATAACGCAACCTGTTCAATCGATATTAATAATTCCAATTCGCCAAATGCGGATGTTGAGATGGGACGTTATCCAACCAGCGCGTTCACCGGGTCAGGTGATGAAGTTGGCGGAGAAGGTAAAAATGGTTCACTGGATATTTCATTAATCGATTGCCCGGATCAGGGCACAGTGCAATTACAGCTGCATGGTACCAGAAAAGATGGTCACGAATCTGTTCTGGAATTAGATAATCCGAATGATGATAATACAGCTAAAAATATCGGTATTATTATTTATAACCGTGACAACATGGATGAGCCTATTACTATTGATGGCGAATCTGAAGAGTATGATGTTGTTTCCAGTACAGAGTGGCATGCAAGCTATGTCGCAAAATATACCAGTACTGCTGACGATGTTGAAGCCGGCCAGGCTGATGCAACATTAAATTATACGCTTTCCTATAATTAATATCAGTGCGCAGATTATTTAATCTGCGCCTTCATTTTATATGATTATTT