Homologs in group_1607

Help

6 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10520 FBDBKF_10520 100.0 Morganella morganii S1 fimA Pilin (type 1 fimbrial protein)
NLDBIP_14685 NLDBIP_14685 100.0 Morganella morganii S4 fimA Pilin (type 1 fimbrial protein)
LHKJJB_14660 LHKJJB_14660 100.0 Morganella morganii S3 fimA Pilin (type 1 fimbrial protein)
HKOGLL_13280 HKOGLL_13280 100.0 Morganella morganii S5 fimA Pilin (type 1 fimbrial protein)
F4V73_RS01850 F4V73_RS01850 27.8 Morganella psychrotolerans - fimbrial protein
F4V73_RS14230 F4V73_RS14230 67.4 Morganella psychrotolerans - fimbrial protein

Distribution of the homologs in the orthogroup group_1607

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1607

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P22595 5.14e-11 62 31 8 177 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
P37921 4.01e-10 59 26 6 194 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P12730 4.21e-09 56 28 7 192 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P55223 1.1e-08 55 27 4 162 3 None Fimbrial subunit type 1 Salmonella typhimurium
P37920 7.7e-08 53 26 7 194 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P43664 8.35e-08 53 28 5 176 3 lpfE Protein LpfE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P62605 8.76e-08 53 29 8 192 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 8.76e-08 53 29 8 192 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P43660 5.92e-06 48 26 8 196 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X5K5 6.04e-05 45 27 9 194 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P42913 0.000169 43 27 9 200 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
P04740 0.000619 42 27 4 125 3 KS71A KS71A fimbrillin Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_14855
Feature type CDS
Gene fimA
Product Pilin (type 1 fimbrial protein)
Location 61807 - 62376 (strand: -1)
Length 570 (nucleotides) / 189 (amino acids)

Contig

Accession ZDB_225
Length 129223 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1607
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis
-

Protein Sequence

MKKSLIGKSLISALLAGTAMSASAVDQTGTISFKGFIYNATCSIDLNDTNSPNVDVLMGRYPTSAFTETGTMVGGKDGYGELNISLTDCPDQGKVKLQLHGQPKDGDNELLELDNPNASTTAKNIAVLIFENGDTNNDPVVIDGSKTEEYNVSSSASWKGSYTAYYYSTADDVEAGQADATLNYTLSYN

Flanking regions ( +/- flanking 50bp)

TTATTCAGCTGACACTGAATAATAAAAAACTCATTTAAATAAGGTTTAAGATGAAAAAATCTTTAATTGGTAAATCATTAATTTCTGCATTACTTGCCGGTACTGCTATGAGTGCATCCGCAGTTGATCAGACAGGTACAATTTCCTTTAAAGGCTTTATTTATAATGCCACCTGTTCGATTGATCTTAACGATACTAACTCTCCTAATGTTGATGTGTTAATGGGTCGTTATCCGACCAGTGCATTTACAGAAACCGGCACTATGGTTGGCGGAAAAGATGGCTACGGTGAACTGAATATTTCATTAACAGACTGCCCGGATCAGGGAAAAGTAAAATTACAGTTACATGGTCAGCCAAAAGATGGTGATAACGAGCTGTTAGAATTAGATAACCCGAACGCAAGTACAACGGCTAAAAATATTGCTGTCCTTATATTTGAGAATGGTGATACCAATAATGACCCTGTTGTGATTGATGGCTCAAAAACAGAGGAATATAACGTATCTTCCAGCGCATCATGGAAGGGAAGTTATACCGCATACTACTACAGTACCGCTGACGACGTTGAAGCCGGCCAGGCGGATGCAACGCTGAATTATACGCTCTCATATAATTAATATTTATGCGCAGATGAAATACTCTGCGCGCCCTCACTATAATAAAATAA