Homologs in group_2354

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19000 FBDBKF_19000 89.1 Morganella morganii S1 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
EHELCC_18745 EHELCC_18745 89.1 Morganella morganii S2 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
NLDBIP_18560 NLDBIP_18560 89.1 Morganella morganii S4 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
LHKJJB_18615 LHKJJB_18615 89.1 Morganella morganii S3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
HKOGLL_18350 HKOGLL_18350 89.1 Morganella morganii S5 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
PMI_RS11045 PMI_RS11045 59.3 Proteus mirabilis HI4320 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

Distribution of the homologs in the orthogroup group_2354

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2354

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N8K7 7.64e-104 304 68 6 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B5BEY4 4.08e-98 289 63 4 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella paratyphi A (strain AKU_12601)
Q5PEG1 4.08e-98 289 63 4 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
C0PXA7 5.24e-98 289 63 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella paratyphi C (strain RKS4594)
Q57KJ4 5.24e-98 289 63 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella choleraesuis (strain SC-B67)
B4T457 2.88e-97 287 63 4 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella newport (strain SL254)
Q8Z471 4.72e-97 286 62 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella typhi
B4TTW1 4.72e-97 286 62 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella schwarzengrund (strain CVM19633)
Q8ZMF6 5.74e-97 286 62 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A6TD39 9.7e-97 286 61 3 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A9N2D3 1.28e-96 285 62 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q66EC3 1.49e-96 285 59 4 246 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
B5XV34 1.57e-96 285 63 5 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Klebsiella pneumoniae (strain 342)
B4TFW7 2.11e-96 285 62 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella heidelberg (strain SL476)
B5RDQ3 2.11e-96 285 62 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QW18 2.11e-96 285 62 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella enteritidis PT4 (strain P125109)
B5FTS5 2.11e-96 285 62 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella dublin (strain CT_02021853)
A9MF28 3.37e-96 284 61 4 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B1JJF8 1.18e-95 283 59 4 246 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
B2K577 1.18e-95 283 59 4 246 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FLX8 1.18e-95 283 59 4 246 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TPZ7 1.37e-95 283 59 4 246 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Yersinia pestis (strain Pestoides F)
Q1CLR6 1.37e-95 283 59 4 246 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R119 1.37e-95 283 59 4 246 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBP6 1.37e-95 283 59 4 246 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Yersinia pestis
B5F411 1.81e-95 283 62 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salmonella agona (strain SL483)
A8G9Z2 1.96e-95 282 60 3 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Serratia proteamaculans (strain 568)
Q1R7U4 3.9e-95 281 62 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli (strain UTI89 / UPEC)
Q8FEJ5 3.9e-95 281 62 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEB1 3.9e-95 281 62 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AEU1 3.9e-95 281 62 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli O1:K1 / APEC
B7MYQ2 3.9e-95 281 62 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli O81 (strain ED1a)
B7MKM1 3.9e-95 281 62 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7LWK8 3.99e-95 281 60 3 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8ANW1 8.07e-95 281 60 3 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B1LQ67 1.03e-94 281 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B5Z3A9 1.37e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X7Y4 1.37e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli O157:H7
Q3YYB5 1.9e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shigella sonnei (strain Ss046)
Q32CI3 1.9e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q31XA9 1.9e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shigella boydii serotype 4 (strain Sb227)
B2TZI4 1.9e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I6D7 1.9e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli (strain SE11)
Q46893 1.9e-94 280 61 3 232 1 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli (strain K12)
B1IUT2 1.9e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A3M6 1.9e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli O9:H4 (strain HS)
B1XCS3 1.9e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli (strain K12 / DH10B)
C4ZZQ1 1.9e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LXF9 1.9e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli O8 (strain IAI1)
B7LEG5 1.9e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli (strain 55989 / EAEC)
A7ZQJ1 1.9e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7C093 2.42e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shigella flexneri
Q0T1H8 2.42e-94 280 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shigella flexneri serotype 5b (strain 8401)
B7NT91 3.87e-94 279 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7N6X7 7.54e-94 278 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7UHG6 2.17e-93 277 61 3 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7MJ57 2.92e-93 277 59 3 239 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
Q6LMT3 3.71e-93 276 60 3 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Photobacterium profundum (strain SS9)
A4WDV2 1.28e-92 275 60 6 245 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Enterobacter sp. (strain 638)
Q6D1B3 1.33e-86 260 56 4 237 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NVM4 2.54e-85 257 57 4 236 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Sodalis glossinidius (strain morsitans)
Q9KUJ2 1.05e-84 255 57 3 237 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87LQ2 4.43e-84 253 56 4 239 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A0KGH5 3.64e-83 251 58 3 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C6DDG2 7.24e-83 251 56 4 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q8EBR2 1.33e-82 250 55 5 251 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B7VK66 1.59e-82 249 53 3 236 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Vibrio atlanticus (strain LGP32)
Q12PZ2 6.77e-82 248 57 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q5E328 1.17e-81 248 54 3 237 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q1LTP8 4.28e-81 246 54 3 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q8DC60 5.87e-81 246 54 2 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Vibrio vulnificus (strain CMCP6)
Q086A8 6.54e-81 245 54 4 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shewanella frigidimarina (strain NCIMB 400)
Q15P31 1.8e-80 244 56 3 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q7MHQ4 2.04e-80 244 54 2 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Vibrio vulnificus (strain YJ016)
B6EKL6 6.4e-80 243 52 4 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Aliivibrio salmonicida (strain LFI1238)
B5FAF7 1.02e-79 243 52 3 237 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Aliivibrio fischeri (strain MJ11)
B3H1E1 2.58e-79 241 51 4 237 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q7VLT5 4.26e-79 241 52 3 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P57953 5.42e-79 241 53 4 237 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pasteurella multocida (strain Pm70)
A5UE59 2.29e-78 239 51 5 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Haemophilus influenzae (strain PittEE)
C4LBQ9 2.34e-78 239 54 4 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A3N0G2 3.04e-78 238 50 3 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q4QMP4 3.21e-78 238 51 5 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Haemophilus influenzae (strain 86-028NP)
O05029 3.28e-78 238 51 5 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHG1 3.28e-78 238 51 5 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Haemophilus influenzae (strain PittGG)
B0BP82 6.59e-78 238 50 3 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B8CJP8 1.56e-77 237 54 3 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shewanella piezotolerans (strain WP3 / JCM 13877)
B4RZG5 4.89e-77 236 52 4 238 3 ispD1 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B0TK06 5.57e-76 233 53 4 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shewanella halifaxensis (strain HAW-EB4)
A3QC79 1.01e-75 233 55 4 224 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A8H1S7 1.71e-75 231 51 3 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
P57495 3.22e-73 226 48 3 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8K9D6 6.06e-73 225 48 3 237 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A8FST0 7.38e-73 225 54 4 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shewanella sediminis (strain HAW-EB3)
Q65Q78 1.16e-71 222 49 4 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q487E9 2.52e-71 221 50 3 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q494E8 2.01e-70 219 45 3 237 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Blochmanniella pennsylvanica (strain BPEN)
Q3IDQ6 2.92e-70 219 49 4 246 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudoalteromonas translucida (strain TAC 125)
Q8D223 1.18e-69 217 44 3 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Wigglesworthia glossinidia brevipalpis
A1S4D9 1.14e-68 214 50 4 244 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A4XWR9 2.01e-67 211 52 3 223 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas mendocina (strain ymp)
Q3JCS9 2.2e-67 211 46 2 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A6VQY1 7.75e-66 207 49 4 240 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0KSC1 4.43e-63 200 49 3 223 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas putida (strain GB-1)
A5W827 1.72e-62 199 48 4 230 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88MF7 3.13e-62 198 49 3 223 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q4ZWQ6 3.16e-62 198 48 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q604M2 7.16e-62 197 47 2 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q3KH90 1.34e-61 196 48 4 230 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q886M1 1.68e-61 196 47 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48F81 1.82e-61 196 48 4 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B1JB36 3.45e-61 195 47 3 223 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas putida (strain W619)
Q4KHF4 1.23e-60 194 45 4 243 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C3K6H8 2.43e-59 191 45 4 243 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas fluorescens (strain SBW25)
Q1I648 2.13e-58 188 48 4 224 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas entomophila (strain L48)
Q2SKW7 5.67e-57 185 41 3 239 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Hahella chejuensis (strain KCTC 2396)
Q02RA5 1.1e-53 176 46 3 230 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V1F5 1.86e-53 176 46 3 230 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas aeruginosa (strain PA7)
P57707 4.38e-53 174 46 3 230 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1QU73 6.04e-52 172 46 5 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B4SR88 2.47e-51 170 44 2 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Stenotrophomonas maltophilia (strain R551-3)
B2I2A2 5.68e-51 169 43 3 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Acinetobacter baumannii (strain ACICU)
A3M5X8 1.91e-50 168 41 3 240 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
A1AX25 4.18e-50 167 40 5 241 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Ruthia magnifica subsp. Calyptogena magnifica
B0V5E6 4.48e-50 167 42 3 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Acinetobacter baumannii (strain AYE)
B2FK90 4.77e-50 167 44 2 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Stenotrophomonas maltophilia (strain K279a)
Q5QUC3 1.26e-49 166 41 8 243 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B0VQH8 1.99e-49 165 42 3 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Acinetobacter baumannii (strain SDF)
A1K644 7.47e-49 164 42 5 242 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Azoarcus sp. (strain BH72)
A5CW51 1.15e-48 164 38 5 240 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q6FAU1 1.3e-47 160 41 4 242 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q5GYK6 3.06e-46 158 42 2 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SUA8 3.06e-46 158 42 2 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P1L0 3.52e-46 158 42 2 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8XYW3 4.9e-46 157 44 6 243 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
C1D558 6.62e-46 156 44 5 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Laribacter hongkongensis (strain HLHK9)
Q5NYJ9 1.58e-45 155 42 4 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q8P9Z1 2.08e-45 156 44 2 236 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UTP4 2.08e-45 156 44 2 236 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Xanthomonas campestris pv. campestris (strain 8004)
B0RU03 4.32e-45 155 44 2 236 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q5F829 3.87e-44 151 43 7 225 1 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1KUV0 4.54e-44 151 44 6 224 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9PDT6 5.13e-44 151 43 3 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Xylella fastidiosa (strain 9a5c)
B4RL14 6.28e-44 151 42 7 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Neisseria gonorrhoeae (strain NCCP11945)
Q82UR9 1.13e-43 150 42 7 242 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q3SK38 2.25e-43 149 41 5 236 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Thiobacillus denitrificans (strain ATCC 25259)
A4JF20 2.39e-43 150 42 3 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2Y751 2.43e-43 149 41 5 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B0U660 3.92e-43 149 43 3 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Xylella fastidiosa (strain M12)
Q47EL2 4.47e-43 149 42 5 231 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Dechloromonas aromatica (strain RCB)
Q1BHA5 5.59e-43 149 42 3 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia orbicola (strain AU 1054)
A0K867 5.59e-43 149 42 3 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia cenocepacia (strain HI2424)
Q9JTM3 6.15e-43 148 43 6 224 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q87DY4 6.36e-43 148 43 3 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I939 6.36e-43 148 43 3 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Xylella fastidiosa (strain M23)
A9AIT5 9.67e-43 148 42 3 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia multivorans (strain ATCC 17616 / 249)
Q39FB8 1.09e-42 148 40 3 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8PLR8 1.13e-42 149 43 2 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Xanthomonas axonopodis pv. citri (strain 306)
Q7NYL6 1.43e-42 147 45 7 224 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0BED6 1.64e-42 147 40 3 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B2JGK2 2.1e-42 147 41 4 227 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B4EC23 2.24e-42 147 41 3 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q0AFW3 5.25e-42 146 42 7 241 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q3BUS8 7.06e-42 147 43 2 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q9JYM4 7.78e-42 145 41 6 224 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M0U7 7.87e-42 145 41 7 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Neisseria meningitidis serogroup C (strain 053442)
Q2SWT6 1.63e-41 145 39 3 226 1 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q472F2 2.35e-41 145 42 5 240 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A1WWZ0 2.72e-40 142 41 6 246 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Halorhodospira halophila (strain DSM 244 / SL1)
Q63T70 2.75e-40 142 39 3 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia pseudomallei (strain K96243)
A3NAL9 2.75e-40 142 39 3 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia pseudomallei (strain 668)
Q3JR99 2.75e-40 142 39 3 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia pseudomallei (strain 1710b)
A3NWE0 2.75e-40 142 39 3 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia pseudomallei (strain 1106a)
A1V500 2.75e-40 142 39 3 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia mallei (strain SAVP1)
Q62JI5 2.75e-40 142 39 3 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia mallei (strain ATCC 23344)
A2SBD6 2.75e-40 142 39 3 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia mallei (strain NCTC 10229)
A3MKM4 2.75e-40 142 39 3 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Burkholderia mallei (strain NCTC 10247)
B2T3X2 6.15e-40 141 39 2 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q13Z31 1.24e-39 140 39 3 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Paraburkholderia xenovorans (strain LB400)
Q21YT7 4.89e-39 143 39 5 234 3 ispDF Bifunctional enzyme IspD/IspF Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A5G938 4.48e-36 131 37 7 245 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Geotalea uraniireducens (strain Rf4)
Q9KGF8 1.04e-35 130 34 6 239 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A0LIS2 5.92e-35 128 38 6 230 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q3A8C6 9.39e-35 127 36 5 253 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q7W5C9 1.06e-34 127 40 6 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
B5EMB5 1.66e-34 127 44 6 230 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J4C0 1.66e-34 127 44 6 230 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q2RFM0 4.77e-34 125 35 6 239 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q746Z9 7.02e-34 125 36 8 241 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q6ARN9 2.79e-33 127 38 9 240 3 ispDF Bifunctional enzyme IspD/IspF Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q7VZN2 2.99e-33 123 41 6 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WCW3 2.99e-33 123 41 6 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q39ZL5 1.13e-32 122 34 5 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q92F40 2.43e-32 121 38 5 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A6TWL0 3.04e-32 121 34 6 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Alkaliphilus metalliredigens (strain QYMF)
Q8YAB5 4.96e-32 120 38 6 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q2LUS9 6.11e-32 120 34 6 239 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Syntrophus aciditrophicus (strain SB)
Q2RTS1 7.77e-32 123 37 6 240 3 ispDF Bifunctional enzyme IspD/IspF Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q027G1 2.16e-31 119 33 5 251 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Solibacter usitatus (strain Ellin6076)
A7Z0L2 4.87e-31 117 33 6 230 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q18CD1 8.14e-31 117 30 4 229 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridioides difficile (strain 630)
Q724H7 8.82e-31 117 38 5 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Listeria monocytogenes serotype 4b (strain F2365)
B0JUF7 1.05e-30 117 36 8 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q4FR76 1.91e-30 117 33 6 262 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A9II44 3.01e-30 115 38 6 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A9KSU6 1.25e-29 114 32 8 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q8YLX9 1.34e-29 114 34 6 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A2BVB5 1.41e-29 114 32 4 231 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Prochlorococcus marinus (strain MIT 9515)
C1F763 1.75e-29 114 33 4 243 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
A7GJZ7 1.82e-29 113 35 5 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q98MX9 1.87e-29 117 35 7 242 3 ispDF Bifunctional enzyme IspD/IspF Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1Q9K8 2.22e-29 114 32 4 259 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q7V2M1 3.09e-29 113 33 6 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q3MAF5 5.86e-29 112 34 6 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A4J0Y3 1.12e-28 112 32 5 239 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
C4Z312 1.21e-28 111 28 7 237 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
P74323 2.01e-28 111 35 7 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A5D5L4 5.46e-28 110 35 5 224 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q65PD2 6.37e-28 109 33 7 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q1MH21 6.54e-28 113 35 8 245 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2W4Q8 7.86e-28 112 36 5 225 3 ispDF Bifunctional enzyme IspD/IspF Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A9VN98 1.95e-27 108 33 7 242 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacillus mycoides (strain KBAB4)
B2J1D2 2.06e-27 108 35 7 240 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q11HV9 2.78e-27 111 35 5 211 3 ispDF Bifunctional enzyme IspD/IspF Chelativorans sp. (strain BNC1)
A3PBH7 2.95e-27 107 32 6 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Prochlorococcus marinus (strain MIT 9301)
Q06755 3.34e-27 107 34 6 228 1 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacillus subtilis (strain 168)
Q6MEE8 8.51e-27 106 32 5 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Protochlamydia amoebophila (strain UWE25)
A2BPT7 2.36e-26 105 31 5 231 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Prochlorococcus marinus (strain AS9601)
A7HXV6 3.66e-26 108 34 6 242 3 ispDF Bifunctional enzyme IspD/IspF Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A0PXS4 5.55e-26 104 32 8 240 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium novyi (strain NT)
Q2K8V5 9.13e-26 107 37 9 243 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8UFF4 1.47e-25 107 36 6 236 3 ispDF Bifunctional enzyme IspD/IspF Agrobacterium fabrum (strain C58 / ATCC 33970)
B3PYS4 1.91e-25 106 37 10 243 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium etli (strain CIAT 652)
Q7UM15 2.44e-25 103 32 7 255 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q31C80 2.5e-25 102 30 5 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Prochlorococcus marinus (strain MIT 9312)
Q73FC1 2.75e-25 102 32 7 242 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacillus cereus (strain ATCC 10987 / NRS 248)
A5N4M5 2.77e-25 102 29 8 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DY87 2.77e-25 102 29 8 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium kluyveri (strain NBRC 12016)
Q6HPT2 2.96e-25 102 32 7 242 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63HB4 2.96e-25 102 32 7 242 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacillus cereus (strain ZK / E33L)
Q81VV5 2.96e-25 102 32 7 242 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacillus anthracis
A0R8F7 2.96e-25 102 32 7 242 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacillus thuringiensis (strain Al Hakam)
A8G3G9 3.17e-25 102 32 6 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Prochlorococcus marinus (strain MIT 9215)
Q81J63 4.37e-25 102 33 8 242 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q0C0N0 6.17e-25 104 35 6 231 3 ispDF Bifunctional enzyme IspD/IspF Hyphomonas neptunium (strain ATCC 15444)
B5ZNB6 7.5e-25 105 35 8 245 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q0BTD5 9.89e-25 104 37 7 226 3 ispDF Bifunctional enzyme IspD/IspF Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
P69834 1.25e-24 102 30 6 232 1 ISPD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic Arabidopsis thaliana
Q67JP5 1.43e-24 101 34 7 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q7VDC7 2.11e-24 100 33 7 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A8MLB1 2.26e-24 100 30 7 237 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Alkaliphilus oremlandii (strain OhILAs)
Q9Z7X5 2.31e-24 99 33 6 223 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlamydia pneumoniae
A9BHR2 4.17e-24 99 29 3 228 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Petrotoga mobilis (strain DSM 10674 / SJ95)
Q5L433 5.04e-24 99 32 6 240 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Geobacillus kaustophilus (strain HTA426)
A8F958 6.69e-24 99 32 7 228 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacillus pumilus (strain SAFR-032)
Q2JUE5 7.3e-24 99 34 6 230 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Synechococcus sp. (strain JA-3-3Ab)
A4IJG4 1.18e-23 98 32 7 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Geobacillus thermodenitrificans (strain NG80-2)
B9KSH8 1.71e-23 97 34 6 228 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A3PJQ3 2.47e-23 97 34 6 228 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q3J2K9 2.94e-23 97 34 6 228 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
O67343 3.9e-23 96 34 8 225 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Aquifex aeolicus (strain VF5)
Q8R7S6 7.95e-23 96 30 4 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q3ALY8 9.49e-23 95 35 8 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Synechococcus sp. (strain CC9605)
A6LPN9 9.8e-23 95 27 5 236 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q92Q90 1.01e-22 99 36 8 236 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium meliloti (strain 1021)
A4WSL5 1.97e-22 95 32 5 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B0C9F6 2.16e-22 95 35 8 236 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Acaryochloris marina (strain MBIC 11017)
Q97EC9 2.4e-22 95 28 7 239 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q46GW4 3.39e-22 94 34 7 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Prochlorococcus marinus (strain NATL2A)
B9JW91 4.16e-22 97 36 12 250 3 ispDF Bifunctional enzyme IspD/IspF Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A5VQP4 5.53e-22 97 31 6 237 3 ispDF Bifunctional enzyme IspD/IspF Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q73G24 5.91e-22 97 31 6 231 3 ispDF Bifunctional enzyme IspD/IspF Wolbachia pipientis wMel
Q31QF6 9.69e-22 93 34 7 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q0S890 1e-21 93 36 8 231 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Rhodococcus jostii (strain RHA1)
Q8FMI3 1.26e-21 93 32 10 244 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A5GMW9 1.3e-21 92 34 5 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Synechococcus sp. (strain WH7803)
B5YF77 2.05e-21 92 35 3 155 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q8NMB8 2.29e-21 93 30 5 244 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A6U8F8 2.3e-21 95 35 9 239 3 ispDF Bifunctional enzyme IspD/IspF Sinorhizobium medicae (strain WSM419)
B2TIF4 2.32e-21 92 30 9 239 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium botulinum (strain Eklund 17B / Type B)
A8IBL6 2.44e-21 95 37 7 232 3 ispDF Bifunctional enzyme IspD/IspF Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A1USA2 2.81e-21 95 30 6 235 3 ispDF Bifunctional enzyme IspD/IspF Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B1WSY4 3.2e-21 92 35 7 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Crocosphaera subtropica (strain ATCC 51142 / BH68)
A9IS87 3.46e-21 94 30 5 220 3 ispDF Bifunctional enzyme IspD/IspF Bartonella tribocorum (strain CIP 105476 / IBS 506)
A4QH60 3.79e-21 92 32 6 244 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Corynebacterium glutamicum (strain R)
Q8YHD8 3.82e-21 94 30 6 233 3 ispDF Bifunctional enzyme IspD/IspF Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57D18 3.82e-21 94 30 6 233 3 ispDF Bifunctional enzyme IspD/IspF Brucella abortus biovar 1 (strain 9-941)
Q2YPW1 3.82e-21 94 30 6 233 3 ispDF Bifunctional enzyme IspD/IspF Brucella abortus (strain 2308)
Q8DL91 3.93e-21 92 35 7 239 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
C1BAC2 3.99e-21 91 36 9 231 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Rhodococcus opacus (strain B4)
Q5N3T2 4.19e-21 91 33 7 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q1QM99 5.62e-21 94 33 6 224 3 ispDF Bifunctional enzyme IspD/IspF Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q9RNZ1 6.7e-21 94 35 5 232 3 ispDF Bifunctional enzyme IspD/IspF Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8G0H4 7.36e-21 94 30 6 233 3 ispDF Bifunctional enzyme IspD/IspF Brucella suis biovar 1 (strain 1330)
A6X0N1 9.41e-21 93 29 7 253 3 ispDF Bifunctional enzyme IspD/IspF Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A7GJ99 1.02e-20 90 31 7 230 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q310X3 1.58e-20 92 35 10 240 3 ispDF Bifunctional enzyme IspD/IspF Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q88W46 1.66e-20 90 30 10 241 3 tarI Ribitol-5-phosphate cytidylyltransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
C3KVS6 1.99e-20 90 31 8 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium botulinum (strain 657 / Type Ba4)
B9MJW2 2.08e-20 89 31 8 227 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A5I7N1 2.65e-20 89 31 8 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FZ94 2.65e-20 89 31 8 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium botulinum (strain ATCC 19397 / Type A)
Q89LQ8 2.81e-20 92 33 7 211 3 ispDF Bifunctional enzyme IspD/IspF Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q6G3Z8 3.79e-20 92 29 7 238 3 ispDF Bifunctional enzyme IspD/IspF Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q5L6V2 3.96e-20 89 28 4 237 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlamydia abortus (strain DSM 27085 / S26/3)
B1KTA8 4.1e-20 89 31 8 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium botulinum (strain Loch Maree / Type A3)
Q4JXJ7 4.27e-20 90 31 8 272 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Corynebacterium jeikeium (strain K411)
C4XSW4 4.82e-20 91 35 9 229 3 ispDF Bifunctional enzyme IspD/IspF Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q7U559 5.84e-20 88 34 6 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Parasynechococcus marenigrum (strain WH8102)
Q3AWK9 7.49e-20 88 34 7 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Synechococcus sp. (strain CC9902)
Q6G164 7.66e-20 90 28 7 232 3 ispDF Bifunctional enzyme IspD/IspF Bartonella quintana (strain Toulouse)
Q9RR90 7.67e-20 88 36 7 225 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
B1I0S9 8.49e-20 90 33 7 237 3 ispDF Bifunctional enzyme IspD/IspF Desulforudis audaxviator (strain MP104C)
C1FMX6 8.72e-20 88 30 8 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium botulinum (strain Kyoto / Type A2)
A5EIY9 1.04e-19 90 31 5 226 3 ispDF Bifunctional enzyme IspD/IspF Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q03A83 1.23e-19 87 27 5 237 3 tarI Ribitol-5-phosphate cytidylyltransferase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B1IGH9 1.55e-19 87 30 8 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium botulinum (strain Okra / Type B1)
Q3ZWE1 2e-19 87 29 8 242 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Dehalococcoides mccartyi (strain CBDB1)
A5FP88 2e-19 87 29 8 242 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q5N8G1 2.06e-19 88 31 6 230 2 ISPD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic Oryza sativa subsp. japonica
Q118M1 2.87e-19 86 35 7 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Trichodesmium erythraeum (strain IMS101)
Q0SQB9 3.68e-19 86 30 10 240 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium perfringens (strain SM101 / Type A)
B9JF01 3.95e-19 89 31 6 235 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A9BE76 4.07e-19 86 32 7 228 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Prochlorococcus marinus (strain MIT 9211)
Q7V647 5.17e-19 85 33 6 229 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Prochlorococcus marinus (strain MIT 9313)
Q8XHQ3 5.28e-19 85 30 10 240 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium perfringens (strain 13 / Type A)
Q0TMM2 5.28e-19 85 30 10 240 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A4YUQ7 6.26e-19 88 33 7 211 3 ispDF Bifunctional enzyme IspD/IspF Bradyrhizobium sp. (strain ORS 278)
Q04XR1 7.43e-19 85 30 6 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04VR0 7.43e-19 85 30 6 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q48230 8.3e-19 88 31 9 234 1 bcs1 Bifunctional ribulose 5-phosphate reductase/CDP-ribitol pyrophosphorylase Bcs1 Haemophilus influenzae
Q253C1 8.67e-19 85 29 5 231 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlamydia felis (strain Fe/C-56)
Q8R6H2 8.92e-19 85 26 5 231 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5Z2R3 1.64e-18 84 34 9 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Nocardia farcinica (strain IFM 10152)
Q824I4 2.13e-18 84 30 5 222 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
A4XLJ3 3.37e-18 84 25 7 229 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B4S8U7 6.42e-18 83 31 11 237 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B7IF61 8.03e-18 82 24 5 241 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Thermosipho africanus (strain TCF52B)
C0ZPR7 9.82e-18 82 31 6 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q3A9N7 1.12e-17 82 30 5 219 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q3SSN8 1.22e-17 84 30 4 207 3 ispDF Bifunctional enzyme IspD/IspF Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q2GEM3 1.4e-17 82 31 6 227 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
A4F6W3 1.55e-17 82 32 5 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q92CV0 1.6e-17 82 27 9 239 3 tarI Ribitol-5-phosphate cytidylyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9X1B3 1.63e-17 82 30 5 226 1 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B1GYT4 1.67e-17 82 28 7 219 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Endomicrobium trichonymphae
Q8Y832 1.7e-17 82 26 9 238 3 tarI Ribitol-5-phosphate cytidylyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B1LBT2 1.75e-17 82 30 5 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Thermotoga sp. (strain RQ2)
Q5FQD6 2.34e-17 84 32 7 243 3 ispDF Bifunctional enzyme IspD/IspF Gluconobacter oxydans (strain 621H)
Q47LV0 2.47e-17 82 32 8 241 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Thermobifida fusca (strain YX)
Q890M1 3.79e-17 81 24 6 237 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Clostridium tetani (strain Massachusetts / E88)
A5IMI1 3.81e-17 80 29 6 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A5V2U9 3.89e-17 83 38 6 180 3 ispDF Bifunctional enzyme IspD/IspF Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q8A0U8 5.15e-17 80 31 8 231 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A6LPA6 6.27e-17 80 26 5 228 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q3ZAD7 6.27e-17 80 30 10 243 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q2IQG8 6.62e-17 82 30 4 225 3 ispDF Bifunctional enzyme IspD/IspF Anaeromyxobacter dehalogenans (strain 2CP-C)
Q5WLT7 8.29e-17 80 31 5 228 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Shouchella clausii (strain KSM-K16)
Q1AU08 1.21e-16 79 34 9 247 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q28Q60 1.29e-16 81 31 6 222 3 ispDF Bifunctional enzyme IspD/IspF Jannaschia sp. (strain CCS1)
A6KXL8 1.32e-16 79 32 10 229 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q8RKI9 1.4e-16 79 29 11 251 1 tarI Ribitol-5-phosphate cytidylyltransferase Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)
Q2G708 1.5e-16 81 33 5 224 3 ispDF Bifunctional enzyme IspD/IspF Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q0I880 1.56e-16 79 33 8 236 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Synechococcus sp. (strain CC9311)
A4SF04 2.09e-16 79 30 9 249 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q7NGU6 2.34e-16 79 31 5 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q7A1W0 2.67e-16 79 28 9 237 3 tarI1 Ribitol-5-phosphate cytidylyltransferase 1 Staphylococcus aureus (strain MW2)
Q6GCL7 2.67e-16 79 28 9 237 3 tarI1 Ribitol-5-phosphate cytidylyltransferase 1 Staphylococcus aureus (strain MSSA476)
Q6GK57 2.67e-16 79 28 9 237 3 tarI1 Ribitol-5-phosphate cytidylyltransferase 1 Staphylococcus aureus (strain MRSA252)
Q7A7V0 2.67e-16 79 28 9 237 1 tarI1 Ribitol-5-phosphate cytidylyltransferase 1 Staphylococcus aureus (strain N315)
Q99WW8 2.67e-16 79 28 9 237 3 tarI1 Ribitol-5-phosphate cytidylyltransferase 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJC1 2.67e-16 79 28 9 237 3 tarI1 Ribitol-5-phosphate cytidylyltransferase 1 Staphylococcus aureus (strain COL)
Q2G1C0 2.67e-16 79 28 9 237 1 tarI Ribitol-5-phosphate cytidylyltransferase 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK15 2.67e-16 79 28 9 237 3 tarI1 Ribitol-5-phosphate cytidylyltransferase 1 Staphylococcus aureus (strain USA300)
Q2YV76 2.84e-16 79 27 9 239 3 tarI2 Ribitol-5-phosphate cytidylyltransferase 2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q07MZ2 3.23e-16 80 30 6 210 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain BisA53)
Q8CQ77 3.34e-16 78 28 10 241 3 tarI Ribitol-5-phosphate cytidylyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8E4B4 3.39e-16 78 27 7 231 3 tarI Ribitol-5-phosphate cytidylyltransferase Streptococcus agalactiae serotype III (strain NEM316)
Q8NYI0 3.41e-16 78 27 9 239 3 tarI2 Ribitol-5-phosphate cytidylyltransferase 2 Staphylococcus aureus (strain MW2)
Q6GCM3 3.41e-16 78 27 9 239 3 tarI2 Ribitol-5-phosphate cytidylyltransferase 2 Staphylococcus aureus (strain MSSA476)
Q2YV73 3.44e-16 78 27 10 240 3 tarI1 Ribitol-5-phosphate cytidylyltransferase 1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
B6YQA2 3.82e-16 78 27 8 231 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Azobacteroides pseudotrichonymphae genomovar. CFP2
Q4A0A8 4.01e-16 78 28 10 243 3 tarI Ribitol-5-phosphate cytidylyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q82GC8 4.41e-16 78 33 8 241 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8DYQ7 5.38e-16 78 27 7 231 3 tarI Ribitol-5-phosphate cytidylyltransferase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3K093 5.57e-16 78 27 7 231 3 tarI Ribitol-5-phosphate cytidylyltransferase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5SLX2 5.7e-16 77 34 7 227 1 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72GN3 5.7e-16 77 34 7 227 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B9K8U1 6.17e-16 77 31 5 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q5L917 7.1e-16 77 32 8 231 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64P77 8.19e-16 77 32 9 231 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bacteroides fragilis (strain YCH46)
Q5HRJ7 9.19e-16 77 27 10 241 3 tarI Ribitol-5-phosphate cytidylyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6GK63 9.97e-16 77 26 9 239 3 tarI2 Ribitol-5-phosphate cytidylyltransferase 2 Staphylococcus aureus (strain MRSA252)
P65177 1.69e-15 76 26 9 239 1 tarI2 Ribitol-5-phosphate cytidylyltransferase 2 Staphylococcus aureus (strain N315)
P65176 1.69e-15 76 26 9 239 3 tarI2 Ribitol-5-phosphate cytidylyltransferase 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJC5 1.69e-15 76 26 9 239 3 tarI2 Ribitol-5-phosphate cytidylyltransferase 2 Staphylococcus aureus (strain COL)
Q2G2C4 1.69e-15 76 26 9 239 1 tarI' Ribitol-5-phosphate cytidylyltransferase 2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q1MR76 2.04e-15 78 29 7 232 3 ispDF Bifunctional enzyme IspD/IspF Lawsonia intracellularis (strain PHE/MN1-00)
Q1J200 2.78e-15 75 35 6 221 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q9L0Q8 2.94e-15 76 33 8 242 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q6ADI0 3.76e-15 77 32 8 227 3 ispDF Bifunctional enzyme IspD/IspF Leifsonia xyli subsp. xyli (strain CTCB07)
Q6NFC1 4.27e-15 75 32 8 236 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q2IW23 5.83e-15 77 31 4 208 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain HaA2)
Q87Q30 5.89e-15 75 29 8 232 3 VP1320 Ribitol-5-phosphate cytidylyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B1HNM7 7.29e-15 74 32 7 228 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Lysinibacillus sphaericus (strain C3-41)
B4SAG7 1.13e-14 74 31 12 239 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q6N6M5 1.19e-14 76 31 4 208 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8F7A0 1.22e-14 74 31 10 241 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72P59 1.22e-14 74 31 10 241 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q720Y7 1.59e-14 73 25 9 239 1 tarI Ribitol-5-phosphate cytidylyltransferase Listeria monocytogenes serotype 4b (strain F2365)
Q165P6 1.6e-14 73 28 5 210 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B3EQ34 1.78e-14 74 27 10 249 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlorobium phaeobacteroides (strain BS1)
A0A0Q3NN41 1.98e-14 73 26 6 231 1 HS5.18 D-fructose-6-phosphate cytidylyltransferase Campylobacter jejuni
Q5S6T3 2.24e-14 75 28 7 253 2 Crppa D-ribitol-5-phosphate cytidylyltransferase Rattus norvegicus
B7GMX1 2.57e-14 74 27 6 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q4FM31 2.86e-14 75 26 7 225 3 ispDF Bifunctional enzyme IspD/IspF Pelagibacter ubique (strain HTCC1062)
Q5RJG7 2.89e-14 75 29 6 237 2 Crppa D-ribitol-5-phosphate cytidylyltransferase Mus musculus
Q8G7E2 2.89e-14 74 27 6 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bifidobacterium longum (strain NCC 2705)
B3DTQ9 2.98e-14 74 27 6 226 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Bifidobacterium longum (strain DJO10A)
Q137C3 3.07e-14 75 29 4 207 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain BisB5)
A0JPF9 3.83e-14 75 26 5 238 2 crppa D-ribitol-5-phosphate cytidylyltransferase Danio rerio
O84468 6.76e-14 72 28 6 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KLN6 6.76e-14 72 28 6 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
A4D126 7.55e-14 73 28 6 237 1 CRPPA D-ribitol-5-phosphate cytidylyltransferase Homo sapiens
Q7MUQ9 8.09e-14 72 28 8 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RJ15 8.5e-14 71 28 8 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
B3QIL5 9.98e-14 73 30 4 208 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain TIE-1)
B2HJ23 1.23e-13 71 34 7 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q214R1 1.39e-13 73 30 5 208 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain BisB18)
B0BCA0 1.42e-13 71 28 6 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B835 1.42e-13 71 28 6 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
E1BCH6 2.03e-13 72 28 6 237 3 CRPPA D-ribitol-5-phosphate cytidylyltransferase Bos taurus
A1VDX6 2.21e-13 72 37 5 156 3 ispDF Bifunctional enzyme IspD/IspF Nitratidesulfovibrio vulgaris (strain DP4)
Q72C30 2.21e-13 72 37 5 156 3 ispDF Bifunctional enzyme IspD/IspF Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q9PJT1 2.48e-13 70 27 7 238 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlamydia muridarum (strain MoPn / Nigg)
Q83MX3 4.54e-13 71 28 8 252 3 ispDF Bifunctional enzyme IspD/IspF Tropheryma whipplei (strain Twist)
Q83NK3 4.54e-13 71 28 8 252 3 ispDF Bifunctional enzyme IspD/IspF Tropheryma whipplei (strain TW08/27)
Q48154 7.2e-13 71 28 9 223 1 acs1 Bifunctional ribulose 5-phosphate reductase/CDP-ribitol pyrophosphorylase Acs1 Haemophilus influenzae
B3QP85 7.22e-13 69 28 11 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q3AS33 7.42e-13 69 30 11 241 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlorobium chlorochromatii (strain CaD3)
Q6AAV8 1.02e-12 69 28 4 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q08113 1.82e-12 69 31 8 228 3 ispDF Bifunctional enzyme IspD/IspF Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q8KCU3 2.19e-12 68 30 12 240 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B3QXK8 6.71e-12 67 25 7 237 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A8LKV5 7.61e-12 68 29 5 217 3 ispDF Bifunctional enzyme IspD/IspF Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B8ZJT5 8.97e-12 66 27 9 240 3 tarI Ribitol-5-phosphate cytidylyltransferase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q8DPI2 1.13e-11 66 27 9 240 1 tarI Ribitol-5-phosphate cytidylyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97QE5 1.13e-11 66 27 9 240 3 tarI Ribitol-5-phosphate cytidylyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04K52 1.13e-11 66 27 9 240 3 tarI Ribitol-5-phosphate cytidylyltransferase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A7HDA2 1.29e-11 67 32 8 239 3 ispDF Bifunctional enzyme IspD/IspF Anaeromyxobacter sp. (strain Fw109-5)
C1CR35 1.38e-11 65 27 9 240 3 tarI Ribitol-5-phosphate cytidylyltransferase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CL05 1.38e-11 65 27 9 240 3 tarI Ribitol-5-phosphate cytidylyltransferase Streptococcus pneumoniae (strain P1031)
C1CEM5 1.38e-11 65 27 9 240 3 tarI Ribitol-5-phosphate cytidylyltransferase Streptococcus pneumoniae (strain JJA)
C1C7P9 1.38e-11 65 27 9 240 3 tarI Ribitol-5-phosphate cytidylyltransferase Streptococcus pneumoniae (strain 70585)
B5E508 1.38e-11 65 27 9 240 3 tarI Ribitol-5-phosphate cytidylyltransferase Streptococcus pneumoniae serotype 19F (strain G54)
A5CTY4 1.42e-11 67 34 9 244 3 ispDF Bifunctional enzyme IspD/IspF Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
B1IC62 1.44e-11 65 27 9 240 3 tarI Ribitol-5-phosphate cytidylyltransferase Streptococcus pneumoniae (strain Hungary19A-6)
Q1GGW9 1.8e-11 66 30 9 224 3 ispDF Bifunctional enzyme IspD/IspF Ruegeria sp. (strain TM1040)
P9WKG9 2.11e-11 65 32 8 233 1 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKG8 2.11e-11 65 32 8 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U8Q7 2.11e-11 65 32 8 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AI41 2.11e-11 65 32 8 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KPR8 2.11e-11 65 32 8 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7TW54 2.5e-11 65 32 8 233 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B8GW85 4.32e-11 65 32 7 234 3 ispDF Bifunctional enzyme IspD/IspF Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A7I5 4.32e-11 65 32 7 234 3 ispDF Bifunctional enzyme IspD/IspF Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B2IQ63 5.12e-11 64 27 9 240 3 tarI Ribitol-5-phosphate cytidylyltransferase Streptococcus pneumoniae (strain CGSP14)
Q743W5 2e-10 62 34 10 235 1 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A6Q2K0 3.85e-10 62 24 7 228 3 ispDF Bifunctional enzyme IspD/IspF Nitratiruptor sp. (strain SB155-2)
A1B890 8.04e-10 62 30 8 226 3 ispDF Bifunctional enzyme IspD/IspF Paracoccus denitrificans (strain Pd 1222)
Q0APQ6 1.12e-09 61 32 5 225 3 ispDF Bifunctional enzyme IspD/IspF Maricaulis maris (strain MCS10)
Q2NAE1 1.22e-09 61 32 8 225 3 ispDF Bifunctional enzyme IspD/IspF Erythrobacter litoralis (strain HTCC2594)
A0PV29 1.87e-09 59 33 7 232 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Mycobacterium ulcerans (strain Agy99)
Q2S210 3.65e-09 58 31 8 228 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Salinibacter ruber (strain DSM 13855 / M31)
Q3B3A7 4.74e-09 58 26 7 219 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q28CZ7 4.99e-09 59 27 8 235 2 crppa D-ribitol-5-phosphate cytidylyltransferase Xenopus tropicalis
O83525 1.16e-08 58 31 4 170 3 ispDF Bifunctional enzyme IspD/IspF Treponema pallidum (strain Nichols)
Q5LRN5 2.53e-08 57 30 7 236 3 ispDF Bifunctional enzyme IspD/IspF Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q2J542 1.32e-07 54 30 7 234 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q30QG7 2.63e-07 54 24 6 224 3 ispDF Bifunctional enzyme IspD/IspF Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q1GTN0 2.76e-07 54 32 7 240 3 ispDF Bifunctional enzyme IspD/IspF Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A7ZCQ2 2.85e-06 51 23 7 227 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter concisus (strain 13826)
A6Q7M3 4.64e-06 50 25 7 226 3 ispDF Bifunctional enzyme IspD/IspF Sulfurovum sp. (strain NBC37-1)
Q5GSM7 1.15e-05 49 28 5 160 3 ispDF Bifunctional enzyme IspD/IspF Wolbachia sp. subsp. Brugia malayi (strain TRS)
A7GZI1 1.82e-05 48 22 5 225 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter curvus (strain 525.92)
Q9CCW6 7.68e-05 46 30 7 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Mycobacterium leprae (strain TN)
B8ZUA7 7.68e-05 46 30 7 235 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Mycobacterium leprae (strain Br4923)
A7I1V2 8.68e-05 46 22 6 225 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B9KEX3 0.000114 46 24 8 225 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q9CEF8 0.000389 45 41 0 60 3 glmU Bifunctional protein GlmU Lactococcus lactis subsp. lactis (strain IL1403)
Q02WW6 0.000422 44 41 0 60 3 glmU Bifunctional protein GlmU Lactococcus lactis subsp. cremoris (strain SK11)
A2RMV7 0.000458 44 41 0 60 3 glmU Bifunctional protein GlmU Lactococcus lactis subsp. cremoris (strain MG1363)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13910
Feature type CDS
Gene ispD
Product 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Location 418502 - 419275 (strand: -1)
Length 774 (nucleotides) / 257 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2354
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01128 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1211 Lipid transport and metabolism (I) I 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00991 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60] Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites		 C5 isoprenoid biosynthesis, non-mevalonate pathway

Protein Sequence

MTGSQPAPDISGISDNVPVTALIPAAGIGTRMQCECPKQYLIVAGKTILEHTLAILLAHPRISQVVVALHPQDTVFSTLPVAHHPRIRTVTGGGERADSVLSGLDYLAAHVPENSWVLVHDAARPCLHLSDLNRLLAVLSEEDTDGRIRGAILASPVRDTMKRGVILPGHTGIDHTVDRTQLWHALTPQFFPLHLLRTCLQQALSQQAVITDEASALEFCGYQPLLVTGRADNIKVTQPEDLALAGFYLSNNNKEQT

Flanking regions ( +/- flanking 50bp)

CAGTCGCAAAGCCGTACTAACTAATCCCTATGATGATAACGCCTCCCGTAATGACCGGCTCACAACCGGCACCGGACATATCCGGTATTTCTGATAATGTTCCGGTGACAGCACTGATCCCCGCCGCAGGGATTGGTACGCGAATGCAGTGTGAATGCCCCAAACAATACCTTATCGTTGCCGGAAAAACCATTTTAGAACATACCCTTGCCATCTTACTGGCGCATCCCCGTATTTCGCAGGTGGTTGTGGCGCTGCATCCGCAGGATACCGTGTTCAGCACCCTGCCTGTGGCACACCATCCCCGCATCCGGACAGTAACCGGCGGCGGCGAGCGGGCGGATTCAGTTCTGTCCGGACTTGATTATCTGGCGGCTCACGTACCTGAAAACAGCTGGGTTCTGGTTCATGATGCAGCACGTCCCTGCCTGCATCTCAGTGATTTAAACCGCCTGCTGGCTGTCCTGTCTGAAGAAGATACAGACGGACGGATCAGGGGGGCGATTCTGGCGTCACCGGTGCGTGACACCATGAAACGGGGCGTGATATTACCCGGACACACAGGTATCGACCATACAGTGGATCGCACACAACTGTGGCATGCACTGACCCCGCAATTCTTTCCGCTTCATCTGCTGCGTACCTGTCTGCAACAGGCGCTTTCTCAGCAGGCGGTGATAACCGATGAAGCATCCGCACTGGAATTTTGTGGCTATCAGCCCCTGTTGGTTACCGGACGTGCGGATAATATTAAAGTCACACAGCCGGAAGACCTCGCGCTTGCCGGGTTCTACCTGTCCAATAACAATAAGGAACAGACATAATGATGAGAATCGGACACGGTTTTGATGTTCATGCTTTCGGCGGCGAAGGC