Homologs in group_2745

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07610 FBDBKF_07610 87.0 Morganella morganii S1 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
EHELCC_13440 EHELCC_13440 87.0 Morganella morganii S2 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
NLDBIP_13885 NLDBIP_13885 87.0 Morganella morganii S4 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
LHKJJB_08965 LHKJJB_08965 87.0 Morganella morganii S3 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
HKOGLL_08515 HKOGLL_08515 87.0 Morganella morganii S5 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN

Distribution of the homologs in the orthogroup group_2745

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2745

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76540 1.71e-54 173 55 2 181 1 eutK Bacterial microcompartment shell protein EutK Escherichia coli (strain K12)
Q9ZFU8 2.82e-40 137 50 3 183 1 eutK Bacterial microcompartment shell protein EutK Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
D0LID5 1.23e-16 74 48 0 84 1 Hoch_5815 Bacterial microcompartment protein homohexamer Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
H9L478 4.8e-15 70 54 0 87 1 pduJ Bacterial microcompartment shell protein PduJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q03511 8.67e-14 67 37 1 86 1 ccmK2 Carboxysome shell protein CcmK2 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P0A1C7 3.13e-13 65 48 0 85 1 pduA Bacterial microcompartment shell protein PduA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1C8 3.13e-13 65 48 0 85 3 pduA Bacterial microcompartment shell protein PduA Salmonella typhi
P0DUV5 3.4e-13 65 52 0 87 1 pduJ Bacterial microcompartment shell protein PduJ Citrobacter freundii
P0DUM6 4.14e-13 65 48 0 85 1 pduA Bacterial microcompartment shell protein PduA Citrobacter freundii
P72761 5.15e-13 65 37 1 89 1 ccmK2 Carboxysome shell protein CcmK2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P23656 7.65e-13 68 37 2 112 3 ccmO Carboxysome assembly protein CcmO Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P23656 8.52e-06 48 29 0 84 3 ccmO Carboxysome assembly protein CcmO Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P46205 7.65e-13 68 37 2 112 1 ccmO Carboxysome assembly protein CcmO Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P46205 8.52e-06 48 29 0 84 1 ccmO Carboxysome assembly protein CcmO Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q31HD2 1.42e-12 63 44 1 86 3 csoS1B Carboxysome shell protein CsoS1B Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q31HD3 1.77e-12 63 44 1 86 1 csoS1A Carboxysome shell protein CsoS1A Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q8DKB2 4.71e-12 62 36 1 86 1 ccmK2 Carboxysome shell protein CcmK2 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q31HD1 6.4e-12 62 45 1 82 1 csoS1C Carboxysome shell protein CsoS1C Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q7V6F7 9.48e-12 62 45 1 82 1 csoS1 Carboxysome shell protein CsoS1 Prochlorococcus marinus (strain MIT 9313)
P0A330 9.68e-12 62 45 1 82 2 csoS1 Carboxysome shell protein CsoS1 Synechococcus sp. (strain WH7803)
P0A328 9.68e-12 62 45 1 82 3 csoS1 Carboxysome shell protein CsoS1 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
P0A329 9.68e-12 62 45 1 82 1 csoS1 Carboxysome shell protein CsoS1 Parasynechococcus marenigrum (strain WH8102)
Q7V2D1 9.78e-12 62 45 1 82 1 csoS1 Major carboxysome shell protein CsoS1 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
O30709 9.82e-12 62 35 1 89 3 ccmK Carboxysome shell protein CcmK Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q8DKB3 1.31e-11 62 34 1 89 1 ccmK1 Carboxysome shell protein CcmK1 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q187N0 1.35e-11 61 44 0 89 1 eutM Bacterial microcompartment shell protein EutM Clostridioides difficile (strain 630)
P41791 1.41e-11 61 46 0 83 1 eutM Bacterial microcompartment shell protein EutM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P72760 1.48e-11 61 34 1 86 1 ccmK1 Carboxysome shell protein CcmK1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0ABF4 1.79e-11 61 46 0 83 1 eutM Bacterial microcompartment shell protein EutM Escherichia coli (strain K12)
P0ABF5 1.79e-11 61 46 0 83 3 eutM Bacterial microcompartment shell protein EutM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7V6G4 1.31e-10 61 42 1 82 3 csoS1E Probable carboxysome shell protein CsoS1E Prochlorococcus marinus (strain MIT 9313)
P45688 1.47e-10 58 42 1 85 1 csoS1C Carboxysome shell protein CsoS1C Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
P45689 1.55e-10 58 42 1 85 1 csoS1A Major carboxysome shell protein CsoS1A Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
P45690 6.25e-10 57 42 1 85 1 csoS1B Carboxysome shell protein CsoS1B Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
Q9XDN6 6.97e-10 58 37 4 120 1 pduK Bacterial microcompartment shell protein PduK Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q55121 2.03e-09 58 39 0 81 3 ccmO Carboxysome assembly protein CcmO Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q55121 1.3e-06 50 38 0 76 3 ccmO Carboxysome assembly protein CcmO Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B1VB70 3.43e-09 56 40 1 80 1 pduK Bacterial microcompartment shell protein PduK Citrobacter freundii
P0DUV7 1.62e-06 49 39 0 64 1 pduT Bacterial microcompartment shell protein PduT Citrobacter freundii
Q9XDM8 1.96e-06 49 37 0 64 1 pduT Bacterial microcompartment shell protein PduT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q31RK2 7.79e-05 43 32 1 84 1 ccmK4 Carboxysome shell protein CcmK4 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
K9Y6N7 0.0001 43 30 1 85 1 ccmK4 Carboxysome shell protein CcmK4 Halothece sp. (strain PCC 7418)
P73406 0.000558 41 25 1 86 1 ccmK3 Carboxysome shell protein CcmK3 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13510
Feature type CDS
Gene -
Product BMC domain-containing protein
Location 336351 - 336917 (strand: -1)
Length 567 (nucleotides) / 188 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2745
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00936 BMC domain
PF16365 Ethanolamine utilization protein EutK C-terminus

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4577 Secondary metabolites biosynthesis, transport and catabolism (Q)
Energy production and conversion (C)		 QC Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04025 ethanolamine utilization protein EutK - -

Protein Sequence

MIDSLGLLEVYGLVSGIDAADAMLKSANVRILNYEMVIPGMVTLVVEGDLAACRAAVDAGIAAASRTGKVVGHKVIGRPDSDTEWLVTGFSGVPVKVKPQSPAPAAAPVAAPVSAPVAEAVNAPDTDALLAFTANAQHRHGVTAGEAAMHFSCLIEESRDALESLFKQGKLRKRGSRYRMKQEGNRDE

Flanking regions ( +/- flanking 50bp)

TGAATGAATAAGGGTATAGTCAGTTCAGTCATTAATACAGGAGAGAGGTCATGATCGATTCGTTGGGATTACTGGAAGTGTACGGTCTGGTGTCCGGCATTGATGCGGCGGATGCGATGCTCAAGTCGGCCAACGTCCGCATCCTTAATTATGAAATGGTGATCCCGGGGATGGTGACCCTTGTTGTTGAAGGCGATCTGGCGGCATGCCGCGCTGCTGTTGATGCGGGCATTGCCGCCGCGTCACGCACCGGCAAAGTGGTTGGTCATAAAGTGATCGGACGCCCTGACAGTGATACCGAATGGCTGGTCACCGGGTTCAGCGGCGTACCGGTTAAGGTCAAACCGCAGTCTCCGGCACCGGCGGCTGCACCTGTTGCCGCGCCGGTTTCCGCACCTGTGGCTGAAGCCGTAAATGCACCGGATACGGATGCTCTGCTGGCGTTTACCGCGAATGCACAGCATCGTCATGGTGTGACCGCCGGTGAAGCCGCTATGCACTTCAGTTGCCTGATTGAAGAGAGCCGCGATGCGCTGGAAAGCCTGTTTAAACAGGGAAAACTGCGCAAACGCGGCAGTCGCTACCGGATGAAACAGGAAGGAAACCGCGATGAGTAACCTGACTGCGGGTCTGCATGAGTGCGGACCCGACATTATTCGTCAGCGGG