Homologs in group_2769

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07610 FBDBKF_07610 100.0 Morganella morganii S1 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
NLDBIP_13885 NLDBIP_13885 100.0 Morganella morganii S4 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
LHKJJB_08965 LHKJJB_08965 100.0 Morganella morganii S3 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
HKOGLL_08515 HKOGLL_08515 100.0 Morganella morganii S5 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
F4V73_RS13510 F4V73_RS13510 87.0 Morganella psychrotolerans - BMC domain-containing protein

Distribution of the homologs in the orthogroup group_2769

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2769

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76540 3.12e-52 167 55 2 178 1 eutK Bacterial microcompartment shell protein EutK Escherichia coli (strain K12)
Q9ZFU8 1.76e-41 140 52 2 180 1 eutK Bacterial microcompartment shell protein EutK Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
D0LID5 2.19e-16 73 50 0 79 1 Hoch_5815 Bacterial microcompartment protein homohexamer Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
P72761 8.3e-14 67 38 1 89 1 ccmK2 Carboxysome shell protein CcmK2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q03511 1.02e-13 67 37 1 86 1 ccmK2 Carboxysome shell protein CcmK2 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
H9L478 1.05e-13 66 51 0 87 1 pduJ Bacterial microcompartment shell protein PduJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1C7 1.05e-12 64 48 0 85 1 pduA Bacterial microcompartment shell protein PduA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1C8 1.05e-12 64 48 0 85 3 pduA Bacterial microcompartment shell protein PduA Salmonella typhi
P0DUM6 1.27e-12 63 48 0 85 1 pduA Bacterial microcompartment shell protein PduA Citrobacter freundii
P0DUV5 2.31e-12 63 50 0 87 1 pduJ Bacterial microcompartment shell protein PduJ Citrobacter freundii
P41791 2.7e-12 63 46 0 83 1 eutM Bacterial microcompartment shell protein EutM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0ABF4 3.71e-12 62 46 0 83 1 eutM Bacterial microcompartment shell protein EutM Escherichia coli (strain K12)
P0ABF5 3.71e-12 62 46 0 83 3 eutM Bacterial microcompartment shell protein EutM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q31HD2 4e-12 62 43 1 86 3 csoS1B Carboxysome shell protein CsoS1B Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q31HD3 4.38e-12 62 43 1 86 1 csoS1A Carboxysome shell protein CsoS1A Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q8DKB2 6.68e-12 62 36 1 86 1 ccmK2 Carboxysome shell protein CcmK2 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q187N0 1.12e-11 61 46 0 89 1 eutM Bacterial microcompartment shell protein EutM Clostridioides difficile (strain 630)
Q8DKB3 1.61e-11 61 34 1 89 1 ccmK1 Carboxysome shell protein CcmK1 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P23656 1.67e-11 64 41 0 81 3 ccmO Carboxysome assembly protein CcmO Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P23656 1.28e-06 50 29 0 84 3 ccmO Carboxysome assembly protein CcmO Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P46205 1.67e-11 64 41 0 81 1 ccmO Carboxysome assembly protein CcmO Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P46205 1.28e-06 50 29 0 84 1 ccmO Carboxysome assembly protein CcmO Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q31HD1 1.78e-11 61 43 1 82 1 csoS1C Carboxysome shell protein CsoS1C Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P72760 1.88e-11 61 34 1 89 1 ccmK1 Carboxysome shell protein CcmK1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7V6F7 4.14e-11 60 43 1 82 1 csoS1 Carboxysome shell protein CsoS1 Prochlorococcus marinus (strain MIT 9313)
O30709 4.46e-11 60 34 1 89 3 ccmK Carboxysome shell protein CcmK Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q7V2D1 4.55e-11 60 43 1 82 1 csoS1 Major carboxysome shell protein CsoS1 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
P0A330 4.6e-11 60 43 1 82 2 csoS1 Carboxysome shell protein CsoS1 Synechococcus sp. (strain WH7803)
P0A328 4.6e-11 60 43 1 82 3 csoS1 Carboxysome shell protein CsoS1 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
P0A329 4.6e-11 60 43 1 82 1 csoS1 Carboxysome shell protein CsoS1 Parasynechococcus marenigrum (strain WH8102)
Q7V6G4 3.32e-10 60 41 1 82 3 csoS1E Probable carboxysome shell protein CsoS1E Prochlorococcus marinus (strain MIT 9313)
P45689 1.24e-09 56 40 1 85 1 csoS1A Major carboxysome shell protein CsoS1A Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
P45688 1.29e-09 56 40 1 85 1 csoS1C Carboxysome shell protein CsoS1C Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
B1VB70 2.08e-09 57 38 1 80 1 pduK Bacterial microcompartment shell protein PduK Citrobacter freundii
Q9XDN6 3.33e-09 56 41 1 78 1 pduK Bacterial microcompartment shell protein PduK Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q55121 4.22e-09 57 39 0 81 3 ccmO Carboxysome assembly protein CcmO Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q55121 1.49e-06 50 36 0 77 3 ccmO Carboxysome assembly protein CcmO Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P45690 5.22e-09 55 40 1 85 1 csoS1B Carboxysome shell protein CsoS1B Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
P0DUV7 1.25e-06 50 39 0 64 1 pduT Bacterial microcompartment shell protein PduT Citrobacter freundii
Q9XDM8 1.86e-06 49 37 0 64 1 pduT Bacterial microcompartment shell protein PduT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
K9Y6N7 6.92e-05 43 33 0 65 1 ccmK4 Carboxysome shell protein CcmK4 Halothece sp. (strain PCC 7418)
Q31RK2 0.000175 42 32 1 84 1 ccmK4 Carboxysome shell protein CcmK4 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P73406 0.000183 42 26 1 82 1 ccmK3 Carboxysome shell protein CcmK3 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_13440
Feature type CDS
Gene ccmK
Product Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
Location 8048 - 8605 (strand: 1)
Length 558 (nucleotides) / 185 (amino acids)
In genomic island -

Contig

Accession ZDB_223
Length 138954 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2769
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00936 BMC domain
PF16365 Ethanolamine utilization protein EutK C-terminus

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4577 Secondary metabolites biosynthesis, transport and catabolism (Q)
Energy production and conversion (C)
QC Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04025 ethanolamine utilization protein EutK - -

Protein Sequence

MIDSLGLLEVYGLVSGIDAADAMLKSANVRILNYEMVIPGMVTLVVEGDLAACRAAVDAGIAAANRTGKVIGHKVIGRPDGDTEWLVTGFSGVPVKVKPQSPAPVPVSEPAPAAAVSAAAPDADAMMIFAAEARHRHGVTAGEAAMHFSCLIEDSRDVLEDLFKQGKLRKRGSRYRVKQEGNRDE

Flanking regions ( +/- flanking 50bp)

TGAGCAGTGCAGTCAGTCGTCAGTTCAGTCATTAACACAGGAGAAAGGTCATGATCGATTCACTGGGATTACTTGAGGTATACGGCCTGGTGTCCGGCATTGATGCGGCGGATGCGATGCTGAAGTCGGCAAATGTCCGCATCCTTAACTATGAAATGGTGATCCCGGGGATGGTGACGCTTGTTGTTGAGGGCGATCTGGCGGCGTGCCGTGCGGCGGTGGATGCGGGCATTGCAGCCGCAAACCGTACCGGTAAAGTGATCGGCCACAAGGTCATCGGTCGTCCGGATGGTGATACCGAGTGGCTGGTCACCGGTTTCAGCGGTGTACCGGTGAAGGTAAAACCGCAGTCTCCGGCACCGGTACCGGTGTCTGAACCGGCTCCGGCGGCAGCTGTTTCTGCCGCCGCCCCGGATGCGGATGCTATGATGATCTTTGCCGCTGAAGCCAGACACCGCCACGGCGTGACTGCCGGAGAAGCGGCCATGCATTTCAGCTGTCTGATAGAGGACAGCCGCGATGTGCTGGAAGACCTGTTTAAACAGGGCAAATTGCGCAAACGCGGCAGCCGCTACCGGGTAAAACAGGAGGGAAACCGCGATGAGTAATCTGATGCCGGGTCTGCATGAGTGCGGGCCCGAAATCATTCGTCAGCGTG