Homologs in group_1860

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13900 FBDBKF_13900 96.6 Morganella morganii S1 fbaA class II fructose-bisphosphate aldolase
EHELCC_11570 EHELCC_11570 96.6 Morganella morganii S2 fbaA class II fructose-bisphosphate aldolase
NLDBIP_11915 NLDBIP_11915 96.6 Morganella morganii S4 fbaA class II fructose-bisphosphate aldolase
LHKJJB_11775 LHKJJB_11775 96.6 Morganella morganii S3 fbaA class II fructose-bisphosphate aldolase
HKOGLL_10385 HKOGLL_10385 96.6 Morganella morganii S5 fbaA class II fructose-bisphosphate aldolase
PMI_RS01180 PMI_RS01180 89.1 Proteus mirabilis HI4320 fbaA class II fructose-bisphosphate aldolase

Distribution of the homologs in the orthogroup group_1860

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1860

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O52402 0.0 668 87 0 358 3 fba Fructose-bisphosphate aldolase Edwardsiella ictaluri (strain 93-146)
P0AB73 0.0 643 84 1 359 3 fbaA Fructose-bisphosphate aldolase class 2 Shigella flexneri
P0AB71 0.0 643 84 1 359 1 fbaA Fructose-bisphosphate aldolase class 2 Escherichia coli (strain K12)
P0AB72 0.0 643 84 1 359 3 fbaA Fructose-bisphosphate aldolase class 2 Escherichia coli O157:H7
P44429 0.0 548 70 1 359 3 fba Fructose-bisphosphate aldolase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K9B2 1.8e-175 494 62 1 358 3 fbaA Fructose-bisphosphate aldolase class 2 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57526 3.94e-172 486 60 1 356 3 fbaA Fructose-bisphosphate aldolase class 2 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q0PAS0 3.42e-170 481 65 2 354 1 fba Fructose-bisphosphate aldolase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A1VYV7 5.3e-170 480 64 2 354 3 fba Fructose-bisphosphate aldolase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q89AB6 1.68e-169 479 59 1 359 3 fbaA Fructose-bisphosphate aldolase class 2 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O51401 1.31e-163 464 61 2 355 1 fba Fructose-bisphosphate aldolase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q96UH7 6.35e-139 402 56 1 351 1 FBA1 Fructose-bisphosphate aldolase 1 Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01)
Q9HGY9 5.37e-135 392 54 1 351 2 fbaA Fructose-bisphosphate aldolase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
P53444 3.51e-134 390 56 2 351 3 fba Fructose-bisphosphate aldolase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q9C2U0 2.58e-130 380 52 2 352 3 FBA1 Fructose-bisphosphate aldolase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q9URB4 1.13e-129 378 54 1 342 1 FBA1 Fructose-bisphosphate aldolase Candida albicans (strain SC5314 / ATCC MYA-2876)
P14540 1.04e-127 373 50 2 351 1 FBA1 Fructose-bisphosphate aldolase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P36580 3.95e-125 367 51 1 356 1 fba1 Fructose-bisphosphate aldolase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8J0N6 6.16e-94 287 46 6 350 2 FBA2 Fructose-bisphosphate aldolase 2 Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01)
P19537 1.19e-77 245 42 10 342 1 fba Fructose-bisphosphate aldolase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q9X8R6 3.16e-77 244 44 8 337 3 fba Fructose-bisphosphate aldolase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O69600 1.89e-76 242 42 8 336 3 fba Fructose-bisphosphate aldolase Mycobacterium leprae (strain TN)
P9WQA3 1.55e-74 237 42 8 349 1 fba Fructose-bisphosphate aldolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQA2 1.55e-74 237 42 8 349 3 fba Fructose-bisphosphate aldolase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67476 1.55e-74 237 42 8 349 3 fba Fructose-bisphosphate aldolase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9ZEM7 7.97e-72 230 41 8 348 1 fba Fructose-bisphosphate aldolase Streptomyces galbus
Q8CNI3 1.96e-28 115 27 10 339 3 fba Fructose-bisphosphate aldolase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM97 1.96e-28 115 27 10 339 3 fba Fructose-bisphosphate aldolase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P47269 7.14e-27 110 30 11 324 3 fba Fructose-bisphosphate aldolase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P67478 1.86e-25 107 25 11 341 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain MW2)
Q6G7I5 1.86e-25 107 25 11 341 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain MSSA476)
Q6GEV0 1.86e-25 107 25 11 341 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain MRSA252)
P99075 1.86e-25 107 25 11 341 1 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain N315)
P67477 1.86e-25 107 25 11 341 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HE75 1.86e-25 107 25 11 341 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain COL)
P75089 3.15e-25 106 27 10 340 3 fba Fructose-bisphosphate aldolase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q9PPP3 1.22e-22 99 28 14 349 3 fba Fructose-bisphosphate aldolase Ureaplasma parvum serovar 3 (strain ATCC 700970)
P13243 1.92e-22 99 26 14 348 1 fbaA Probable fructose-bisphosphate aldolase Bacillus subtilis (strain 168)
A7ZAH2 1.93e-21 96 30 11 306 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P42420 8.36e-21 94 27 11 337 1 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Bacillus subtilis (strain 168)
P94453 1.75e-20 93 27 11 310 3 fba Fructose-bisphosphate aldolase Geobacillus stearothermophilus
Q7CPQ7 1.74e-19 90 26 11 325 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGZ9 1.74e-19 90 26 11 325 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella typhi
A9N6Z8 2.77e-19 90 26 11 325 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
D4GYE0 7.31e-19 89 25 10 339 1 fba Fructose-bisphosphate aldolase class 2 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q9XDP3 8.7e-19 89 26 17 369 3 fba Fructose-bisphosphate aldolase Nostoc commune
Q9I5Y1 1.46e-18 89 26 17 376 3 fba Fructose-bisphosphate aldolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q56815 1.66e-18 89 26 15 365 1 cbbA Fructose-bisphosphate aldolase Xanthobacter flavus
Q65D09 1.75e-18 87 26 11 338 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B5BGG5 1.84e-18 87 26 11 325 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi A (strain AKU_12601)
Q5PL86 1.84e-18 87 26 11 325 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi A (strain ATCC 9150 / SARB42)
O87796 1.86e-18 88 27 18 378 3 fba Fructose-bisphosphate aldolase Stutzerimonas stutzeri
Q8YNK2 2.05e-18 88 26 15 369 1 fda Fructose-bisphosphate aldolase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P68906 3.6e-18 87 27 15 339 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M18 (strain MGAS8232)
P68905 3.6e-18 87 27 15 339 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M1
P0CJ44 4.58e-18 87 27 7 269 1 CIMG_05755 Putative fructose-bisphosphate aldolase Coccidioides immitis (strain RS)
Q55664 4.77e-18 87 24 13 369 1 fbaA Fructose-bisphosphate aldolase class 2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5XA12 5.12e-18 86 27 15 339 1 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A6TEF4 5.41e-18 86 26 12 325 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q8VS16 9.19e-18 85 25 11 327 1 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Klebsiella oxytoca
Q83QY5 1.11e-17 85 25 13 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella flexneri
P0CZ59 1.23e-17 85 27 15 339 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ58 1.23e-17 85 27 15 339 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q0T342 1.37e-17 85 25 13 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella flexneri serotype 5b (strain 8401)
P0A4S2 1.47e-17 85 25 13 339 1 fba Fructose-bisphosphate aldolase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4S1 1.47e-17 85 25 13 339 3 fba Fructose-bisphosphate aldolase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A7ZNR5 3.47e-17 84 25 13 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O139:H28 (strain E24377A / ETEC)
B7NCC6 5.33e-17 83 25 13 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A0A2P6MHY1 7.65e-17 83 25 11 327 1 sqiA Sulfofructosephosphate aldolase Alkalicoccus urumqiensis
P0C8J6 8.58e-17 82 24 12 327 1 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain K12)
B1IYY4 8.58e-17 82 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A1W1 8.58e-17 82 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O9:H4 (strain HS)
B1X7I7 8.58e-17 82 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain K12 / DH10B)
C4ZSI0 8.58e-17 82 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain K12 / MC4100 / BW2952)
B5YV43 9.83e-17 82 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4R2 9.83e-17 82 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O157:H7
P0C8J7 1.21e-16 82 25 13 327 1 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli
B7NKL0 1.37e-16 82 25 11 334 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8FFY7 2.27e-16 81 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7UFB3 2.55e-16 81 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P77704 2.58e-16 81 27 9 272 1 ydjI Uncharacterized protein YdjI Escherichia coli (strain K12)
B4T6B9 2.81e-16 81 25 11 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella newport (strain SL254)
A8B2U2 2.99e-16 82 23 12 343 1 fba Fructose-bisphosphate aldolase Giardia intestinalis (strain ATCC 50803 / WB clone C6)
C0PZ24 3.03e-16 81 25 11 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi C (strain RKS4594)
B4TIX9 3.03e-16 81 25 11 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella heidelberg (strain SL476)
B5REK6 3.03e-16 81 25 11 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZS8 3.03e-16 81 25 11 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella enteritidis PT4 (strain P125109)
B1LFP2 3.05e-16 81 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain SMS-3-5 / SECEC)
B7NDC5 3.05e-16 81 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B2TY92 3.09e-16 81 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7M477 3.09e-16 81 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O8 (strain IAI1)
B4TWB0 3.34e-16 81 24 10 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella schwarzengrund (strain CVM19633)
B7L9W7 3.44e-16 81 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain 55989 / EAEC)
A9MPP7 4.1e-16 81 25 12 330 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7NPN7 5.53e-16 80 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q9KIP8 5.79e-16 80 25 11 332 1 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli
B1LN92 5.92e-16 80 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain SMS-3-5 / SECEC)
Q3Z0B4 6.64e-16 80 23 11 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella sonnei (strain Ss046)
Q1R6K0 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain UTI89 / UPEC)
B6I1L2 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain SE11)
P0AB74 6.95e-16 80 25 11 332 1 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain K12)
B1IRH9 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AB75 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCW8 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AG46 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O1:K1 / APEC
A8A4V3 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O9:H4 (strain HS)
B1XGU9 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain K12 / DH10B)
C4ZR47 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain K12 / MC4100 / BW2952)
B7M045 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O8 (strain IAI1)
B7N0S6 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O81 (strain ED1a)
B5YS30 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AB76 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O157:H7
B7LH72 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain 55989 / EAEC)
B7MB62 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZS33 6.95e-16 80 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0TFZ6 8.3e-16 80 23 11 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q323C6 1.28e-15 79 23 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella boydii serotype 4 (strain Sb227)
Q1R9X7 1.76e-15 79 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain UTI89 / UPEC)
A1ACW2 1.76e-15 79 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O1:K1 / APEC
B7MEF1 1.76e-15 79 24 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O45:K1 (strain S88 / ExPEC)
A8AQ28 1.92e-15 79 24 11 330 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q57JK9 2.02e-15 79 27 10 284 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella choleraesuis (strain SC-B67)
Q703I2 2.06e-15 79 25 11 337 1 fba Fructose-bisphosphate aldolase Thermus caldophilus
B7UJ37 2.23e-15 79 25 11 332 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A4WEV6 7.68e-15 77 24 11 334 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Enterobacter sp. (strain 638)
Q5WKY5 1.46e-14 76 27 10 305 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Shouchella clausii (strain KSM-K16)
Q32EA9 1.89e-14 76 23 12 327 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella dysenteriae serotype 1 (strain Sd197)
Q9KAH3 6.12e-14 74 23 9 338 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B7LMU4 8.75e-14 74 25 12 334 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q59100 1.28e-13 74 24 13 355 3 cbbAC Fructose-bisphosphate aldolase, chromosomal Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
O83668 1.7e-13 73 27 14 316 3 fba Fructose-bisphosphate aldolase Treponema pallidum (strain Nichols)
Q59101 8.4e-13 72 26 16 358 3 cbbAP Fructose-bisphosphate aldolase, plasmid Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P56888 5.59e-12 69 23 15 359 3 cbbA Fructose-bisphosphate aldolase Sinorhizobium medicae (strain WSM419)
P56109 5.81e-12 69 25 9 297 1 fba Fructose-bisphosphate aldolase Helicobacter pylori (strain ATCC 700392 / 26695)
P58336 8.94e-12 68 24 17 357 3 cbbA Fructose-bisphosphate aldolase Rhizobium meliloti (strain 1021)
Q9ZMQ6 1.36e-11 68 25 9 297 3 fba Fructose-bisphosphate aldolase Helicobacter pylori (strain J99 / ATCC 700824)
P29271 6.47e-09 60 23 16 366 3 cfxB Fructose-bisphosphate aldolase 2 Cereibacter sphaeroides
P27995 1.18e-07 56 25 14 302 3 cfxA Fructose-bisphosphate aldolase 1 Cereibacter sphaeroides

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12765
Feature type CDS
Gene fbaA
Product class II fructose-bisphosphate aldolase
Location 152746 - 153822 (strand: -1)
Length 1077 (nucleotides) / 358 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1860
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01116 Fructose-bisphosphate aldolase class-II

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0191 Carbohydrate transport and metabolism (G) G Fructose/tagatose bisphosphate aldolase

Kegg Ortholog Annotation(s)

Protein Sequence

MSKVFDFVKPGVVTGDDVQKIFAVAKENKFALPAVNCVGTDSINAVLEAAAKVRSPVIVQFSNGGAAFIAGKGFKGEGQQAAVLGAISGAHHVHQMAEYYGVPVILHTDHCAKKLLPWLDGLLDAGEKHFAATGKPLFSSHMIDLSEESLEENIEISSKYLTRMAKIGMTLEIELGCTGGEEDGVDNSHLDNSSLYTQPEDVAYAYEKLNAISPRFTIAASFGNVHGVYKPGNVQLTPKILRNSQDYVSEKYNLPHNSLDFVFHGGSGSTAEEIKEAVGYGVVKMNIDTDTQWATWEGILHYYQKNEAYLQGQLGNPEGADKPNKKYYDPRAWLRAAQQTMIERLEKAFTELNSTNVL

Flanking regions ( +/- flanking 50bp)

GCTCCGGTTGCCCGTGACAACTTCCGACAGACCAATACAGGAAATTTGACATGTCTAAAGTTTTTGATTTTGTAAAACCCGGTGTCGTCACTGGCGATGATGTTCAGAAAATCTTTGCTGTTGCCAAAGAAAATAAATTTGCGCTGCCAGCGGTAAACTGCGTCGGTACAGACTCGATCAACGCCGTATTAGAAGCGGCAGCCAAAGTCCGTTCTCCTGTCATTGTTCAGTTCTCCAACGGTGGTGCTGCATTTATCGCCGGGAAAGGTTTTAAAGGCGAAGGCCAGCAGGCTGCAGTTCTGGGCGCGATTTCCGGTGCGCATCATGTGCATCAGATGGCGGAATATTACGGTGTGCCGGTTATTCTGCATACTGACCACTGCGCGAAGAAATTACTGCCATGGTTAGACGGGCTGCTGGACGCGGGTGAAAAACACTTTGCTGCAACCGGTAAACCCCTGTTCTCTTCTCACATGATTGACCTGTCAGAAGAGTCCCTGGAAGAAAATATTGAAATTAGCAGCAAATACCTGACGCGCATGGCGAAAATTGGTATGACCCTGGAAATTGAACTGGGTTGTACCGGCGGTGAAGAAGATGGTGTGGATAACTCCCACCTGGATAATTCCTCACTGTATACTCAGCCGGAAGACGTGGCATACGCCTATGAAAAACTGAATGCAATCAGCCCGCGTTTTACTATTGCAGCGTCATTCGGTAACGTTCATGGTGTTTATAAGCCGGGTAATGTGCAGTTAACACCGAAAATTCTGCGCAATTCTCAGGACTATGTGTCTGAGAAATATAACCTGCCGCACAACAGCCTGGATTTCGTCTTCCACGGCGGCTCAGGCTCTACAGCAGAAGAGATCAAAGAAGCAGTCGGTTATGGTGTGGTGAAAATGAATATCGATACTGATACTCAGTGGGCGACCTGGGAAGGGATCCTGCACTATTACCAGAAAAACGAAGCTTACTTGCAGGGTCAGTTAGGTAACCCTGAAGGTGCTGATAAACCAAACAAAAAATATTATGATCCGCGTGCCTGGTTACGTGCCGCTCAGCAGACCATGATTGAACGTCTGGAAAAAGCATTTACTGAACTGAACAGCACCAACGTTCTGTAATATTTTCTGCGTGAATAATTAAGCCGTCCGGTATAAAACAGGGCGGCTTT