Homologs in group_1898

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13900 FBDBKF_13900 89.7 Morganella morganii S1 fbaA class II fructose-bisphosphate aldolase
EHELCC_11570 EHELCC_11570 89.7 Morganella morganii S2 fbaA class II fructose-bisphosphate aldolase
NLDBIP_11915 NLDBIP_11915 89.7 Morganella morganii S4 fbaA class II fructose-bisphosphate aldolase
LHKJJB_11775 LHKJJB_11775 89.7 Morganella morganii S3 fbaA class II fructose-bisphosphate aldolase
HKOGLL_10385 HKOGLL_10385 89.7 Morganella morganii S5 fbaA class II fructose-bisphosphate aldolase
F4V73_RS12765 F4V73_RS12765 89.1 Morganella psychrotolerans fbaA class II fructose-bisphosphate aldolase

Distribution of the homologs in the orthogroup group_1898

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1898

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O52402 0.0 658 86 1 359 3 fba Fructose-bisphosphate aldolase Edwardsiella ictaluri (strain 93-146)
P0AB73 0.0 656 85 0 359 3 fbaA Fructose-bisphosphate aldolase class 2 Shigella flexneri
P0AB71 0.0 656 85 0 359 1 fbaA Fructose-bisphosphate aldolase class 2 Escherichia coli (strain K12)
P0AB72 0.0 656 85 0 359 3 fbaA Fructose-bisphosphate aldolase class 2 Escherichia coli O157:H7
P44429 0.0 555 71 0 359 3 fba Fructose-bisphosphate aldolase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K9B2 0.0 508 63 1 358 3 fbaA Fructose-bisphosphate aldolase class 2 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57526 1.2e-179 505 63 0 356 3 fbaA Fructose-bisphosphate aldolase class 2 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AB6 1.34e-173 489 61 0 359 3 fbaA Fructose-bisphosphate aldolase class 2 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1VYV7 9.93e-172 484 65 2 355 3 fba Fructose-bisphosphate aldolase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q0PAS0 1.66e-171 484 65 2 355 1 fba Fructose-bisphosphate aldolase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
O51401 5.72e-166 470 61 1 355 1 fba Fructose-bisphosphate aldolase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q96UH7 1.2e-135 393 55 2 352 1 FBA1 Fructose-bisphosphate aldolase 1 Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01)
P53444 1.83e-134 390 56 2 347 3 fba Fructose-bisphosphate aldolase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q9HGY9 6.77e-131 381 54 2 348 2 fbaA Fructose-bisphosphate aldolase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q9C2U0 8.79e-130 379 53 3 345 3 FBA1 Fructose-bisphosphate aldolase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q9URB4 1.05e-126 370 54 2 343 1 FBA1 Fructose-bisphosphate aldolase Candida albicans (strain SC5314 / ATCC MYA-2876)
P14540 1.57e-124 365 49 3 352 1 FBA1 Fructose-bisphosphate aldolase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P36580 4.17e-119 351 49 2 357 1 fba1 Fructose-bisphosphate aldolase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8J0N6 1.91e-91 281 46 8 349 2 FBA2 Fructose-bisphosphate aldolase 2 Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01)
P19537 1.08e-75 240 41 9 341 1 fba Fructose-bisphosphate aldolase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
O69600 4.32e-75 238 41 7 335 3 fba Fructose-bisphosphate aldolase Mycobacterium leprae (strain TN)
P9WQA3 1.12e-72 232 43 8 339 1 fba Fructose-bisphosphate aldolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQA2 1.12e-72 232 43 8 339 3 fba Fructose-bisphosphate aldolase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67476 1.12e-72 232 43 8 339 3 fba Fructose-bisphosphate aldolase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9X8R6 2.1e-72 231 41 7 336 3 fba Fructose-bisphosphate aldolase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9ZEM7 6e-68 220 40 8 344 1 fba Fructose-bisphosphate aldolase Streptomyces galbus
Q8CNI3 3.7e-25 106 28 10 311 3 fba Fructose-bisphosphate aldolase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM97 3.7e-25 106 28 10 311 3 fba Fructose-bisphosphate aldolase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P47269 3.06e-24 103 29 10 319 3 fba Fructose-bisphosphate aldolase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75089 6.97e-23 100 28 14 328 3 fba Fructose-bisphosphate aldolase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P67478 7e-23 100 26 11 331 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain MW2)
Q6G7I5 7e-23 100 26 11 331 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain MSSA476)
Q6GEV0 7e-23 100 26 11 331 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain MRSA252)
P99075 7e-23 100 26 11 331 1 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain N315)
P67477 7e-23 100 26 11 331 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HE75 7e-23 100 26 11 331 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain COL)
Q9PPP3 4.18e-21 95 27 12 346 3 fba Fructose-bisphosphate aldolase Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q7CPQ7 2.51e-20 92 27 13 323 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGZ9 2.51e-20 92 27 13 323 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella typhi
A9N6Z8 3.44e-20 92 27 13 323 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
P94453 5.01e-20 92 27 11 320 3 fba Fructose-bisphosphate aldolase Geobacillus stearothermophilus
P13243 8.21e-20 91 26 13 327 1 fbaA Probable fructose-bisphosphate aldolase Bacillus subtilis (strain 168)
A6TEF4 1.03e-19 91 26 12 323 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7ZAH2 1.1e-19 91 29 9 290 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
O87796 1.33e-19 92 28 13 317 3 fba Fructose-bisphosphate aldolase Stutzerimonas stutzeri
Q9I5Y1 1.8e-19 91 27 12 315 3 fba Fructose-bisphosphate aldolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q83QY5 2.37e-19 90 27 13 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella flexneri
Q0T342 2.92e-19 90 27 13 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella flexneri serotype 5b (strain 8401)
B5BGG5 2.95e-19 89 27 13 323 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi A (strain AKU_12601)
Q5PL86 2.95e-19 89 27 13 323 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P42420 3.02e-19 90 30 12 302 1 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Bacillus subtilis (strain 168)
D4GYE0 3.14e-19 90 25 10 329 1 fba Fructose-bisphosphate aldolase class 2 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
B4TWB0 6.12e-19 89 27 9 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella schwarzengrund (strain CVM19633)
Q9KIP8 6.31e-19 89 27 12 323 1 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli
A7ZNR5 6.56e-19 89 27 13 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O139:H28 (strain E24377A / ETEC)
P0A4S2 7.81e-19 89 25 10 343 1 fba Fructose-bisphosphate aldolase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4S1 7.81e-19 89 25 10 343 3 fba Fructose-bisphosphate aldolase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A8AQ28 1.12e-18 88 26 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8VS16 1.14e-18 88 27 10 284 1 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Klebsiella oxytoca
B4T6B9 1.15e-18 88 28 10 280 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella newport (strain SL254)
Q57JK9 1.22e-18 88 28 10 280 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella choleraesuis (strain SC-B67)
C0PZ24 1.27e-18 88 28 10 280 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi C (strain RKS4594)
B4TIX9 1.27e-18 88 28 10 280 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella heidelberg (strain SL476)
B5REK6 1.27e-18 88 28 10 280 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZS8 1.27e-18 88 28 10 280 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella enteritidis PT4 (strain P125109)
B7NCC6 1.29e-18 88 27 13 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q5XA12 1.34e-18 88 25 11 343 1 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P68906 2.19e-18 87 25 11 343 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M18 (strain MGAS8232)
P68905 2.19e-18 87 25 11 343 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M1
B5YV43 2.2e-18 87 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4R2 2.2e-18 87 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O157:H7
P0C8J7 2.22e-18 87 26 12 318 1 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli
P0C8J6 2.29e-18 87 26 12 318 1 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain K12)
B1IYY4 2.29e-18 87 26 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A1W1 2.29e-18 87 26 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O9:H4 (strain HS)
B1X7I7 2.29e-18 87 26 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain K12 / DH10B)
C4ZSI0 2.29e-18 87 26 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain K12 / MC4100 / BW2952)
B7UFB3 2.5e-18 87 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8FFY7 2.57e-18 87 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFZ6 2.57e-18 87 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7NKL0 4.2e-18 86 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1LFP2 4.29e-18 86 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain SMS-3-5 / SECEC)
B7NDC5 4.29e-18 86 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NPN7 5.37e-18 86 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1LN92 6.04e-18 86 26 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain SMS-3-5 / SECEC)
Q65D09 6.27e-18 86 25 10 338 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q3Z0B4 6.47e-18 86 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella sonnei (strain Ss046)
B2TY92 7e-18 85 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7M477 7e-18 85 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O8 (strain IAI1)
P0CZ59 7.88e-18 85 25 11 343 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ58 7.88e-18 85 25 11 343 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
B7L9W7 8.1e-18 85 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain 55989 / EAEC)
P0CJ44 8.16e-18 86 26 8 277 1 CIMG_05755 Putative fructose-bisphosphate aldolase Coccidioides immitis (strain RS)
Q1R6K0 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain UTI89 / UPEC)
B6I1L2 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain SE11)
P0AB74 8.34e-18 85 27 12 323 1 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain K12)
B1IRH9 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AB75 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCW8 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AG46 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O1:K1 / APEC
A8A4V3 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O9:H4 (strain HS)
B1XGU9 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain K12 / DH10B)
C4ZR47 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain K12 / MC4100 / BW2952)
B7M045 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O8 (strain IAI1)
B7N0S6 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O81 (strain ED1a)
B5YS30 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AB76 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O157:H7
B7LH72 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain 55989 / EAEC)
B7MB62 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZS33 8.34e-18 85 27 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1R9X7 1.23e-17 85 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain UTI89 / UPEC)
A1ACW2 1.23e-17 85 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O1:K1 / APEC
B7MEF1 1.23e-17 85 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O45:K1 (strain S88 / ExPEC)
Q323C6 3.21e-17 84 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella boydii serotype 4 (strain Sb227)
A9MPP7 3.53e-17 84 26 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7UJ37 3.79e-17 84 26 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8YNK2 1.57e-16 83 26 13 350 1 fda Fructose-bisphosphate aldolase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9XDP3 3.24e-16 82 26 14 350 3 fba Fructose-bisphosphate aldolase Nostoc commune
Q32EA9 3.34e-16 81 25 12 318 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella dysenteriae serotype 1 (strain Sd197)
A4WEV6 3.78e-16 81 25 11 318 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Enterobacter sp. (strain 638)
B7LMU4 4.37e-16 80 26 12 323 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q5WKY5 5.8e-16 80 25 10 341 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Shouchella clausii (strain KSM-K16)
A8B2U2 1.59e-15 79 24 13 357 1 fba Fructose-bisphosphate aldolase Giardia intestinalis (strain ATCC 50803 / WB clone C6)
A0A2P6MHY1 1.96e-15 79 26 10 294 1 sqiA Sulfofructosephosphate aldolase Alkalicoccus urumqiensis
Q56815 8.45e-15 78 25 14 344 1 cbbA Fructose-bisphosphate aldolase Xanthobacter flavus
Q703I2 1.36e-14 77 25 12 332 1 fba Fructose-bisphosphate aldolase Thermus caldophilus
Q9KAH3 2.02e-14 76 26 8 280 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P77704 3.24e-14 75 26 9 273 1 ydjI Uncharacterized protein YdjI Escherichia coli (strain K12)
Q55664 8.03e-14 75 25 14 344 1 fbaA Fructose-bisphosphate aldolase class 2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O83668 1.64e-13 73 28 14 316 3 fba Fructose-bisphosphate aldolase Treponema pallidum (strain Nichols)
Q59100 2.31e-12 70 24 15 368 3 cbbAC Fructose-bisphosphate aldolase, chromosomal Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q59101 2.17e-11 67 26 12 318 3 cbbAP Fructose-bisphosphate aldolase, plasmid Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P56109 6e-11 66 26 10 293 1 fba Fructose-bisphosphate aldolase Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZMQ6 1.18e-10 65 25 10 293 3 fba Fructose-bisphosphate aldolase Helicobacter pylori (strain J99 / ATCC 700824)
P56888 9.88e-10 62 23 15 367 3 cbbA Fructose-bisphosphate aldolase Sinorhizobium medicae (strain WSM419)
P58336 1.11e-09 62 24 17 367 3 cbbA Fructose-bisphosphate aldolase Rhizobium meliloti (strain 1021)
P29271 5.82e-07 54 23 17 358 3 cfxB Fructose-bisphosphate aldolase 2 Cereibacter sphaeroides
P27995 1.19e-06 53 25 13 306 3 cfxA Fructose-bisphosphate aldolase 1 Cereibacter sphaeroides

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01180
Feature type CDS
Gene fbaA
Product class II fructose-bisphosphate aldolase
Location 290930 - 292009 (strand: 1)
Length 1080 (nucleotides) / 359 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1898
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01116 Fructose-bisphosphate aldolase class-II

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0191 Carbohydrate transport and metabolism (G) G Fructose/tagatose bisphosphate aldolase

Kegg Ortholog Annotation(s)

Protein Sequence

MSKVFDFVKPGVITGDDVQKVFAVAKENNFALPAVNCVGTDSINAVLEAAAKVRSPVIVQFSNGGAAFIAGKGLKAEAPQQAAILGAISGAHHVHQMAEYYGVPVILHTDHCAKKLLPWIDGLLDAGEKHYAKTGKPLFSSHMIDLSEESLEENIEICSKYLARMAKIDMTLEIELGCTGGEEDGVDNTGMDSSALYTQPEDVAYAYEKLNAISPRFTIAASFGNVHGVYKPGNVQLTPKILRNSQDYVSEKYNLPHNSLNFVFHGGSGSSAEEIKEAVSYGVVKMNIDTDTQWATWDGILQFYKKNEGYLQSQLGNPEGADKPNKKYYDPRNWLRHGQTSMVVRLEQAFKELNAIDVL

Flanking regions ( +/- flanking 50bp)

TACAGGTAGAGTGTAAAACTCTGCCTGTTCCAAATATAGGATCTTATTACATGTCTAAAGTTTTTGATTTCGTAAAACCGGGTGTCATCACTGGTGATGATGTACAAAAAGTATTTGCAGTAGCAAAAGAAAATAATTTTGCTCTGCCTGCAGTTAACTGCGTAGGTACAGACTCAATTAATGCTGTATTAGAAGCAGCTGCGAAAGTGCGTTCTCCTGTTATTGTTCAATTCTCTAATGGTGGTGCTGCATTTATCGCAGGTAAAGGTCTTAAAGCTGAAGCGCCACAACAAGCGGCTATCCTAGGGGCTATTTCTGGTGCTCACCATGTACACCAAATGGCAGAATACTATGGTGTTCCTGTTATTTTACACACTGACCACTGTGCGAAAAAACTGTTACCTTGGATTGATGGTCTGTTAGATGCAGGTGAAAAACACTATGCGAAAACAGGTAAACCACTATTCTCTTCTCATATGATTGACTTATCAGAAGAGTCATTAGAAGAAAATATTGAAATCTGTTCTAAATATTTAGCGCGTATGGCTAAAATCGATATGACTTTAGAAATCGAATTAGGCTGTACTGGTGGTGAAGAAGATGGCGTTGATAACACAGGTATGGATAGCTCTGCGCTATATACCCAACCTGAAGACGTTGCTTACGCTTATGAAAAACTAAATGCTATCAGCCCACGTTTCACTATCGCTGCATCATTTGGTAATGTTCACGGCGTTTATAAACCAGGTAACGTTCAATTAACACCAAAAATTCTTCGTAACTCACAAGACTATGTGTCAGAGAAATACAATCTGCCACACAATAGCTTAAACTTTGTTTTCCACGGTGGTTCTGGTTCATCTGCAGAAGAAATCAAAGAAGCTGTAAGCTACGGTGTTGTGAAAATGAATATCGATACTGATACTCAATGGGCAACTTGGGACGGTATCTTACAGTTCTACAAAAAGAACGAAGGCTATTTACAAAGCCAATTAGGTAATCCAGAAGGCGCTGATAAACCTAACAAGAAATACTATGATCCACGTAACTGGTTACGTCATGGTCAAACATCAATGGTTGTTCGTTTAGAGCAAGCATTTAAAGAGCTAAATGCGATTGATGTTCTGTAATACAATTTTATTGTAATACACCTAAAAAACCCGCTTAGTATGCGGGTTTT