Homologs in group_2935

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13785 FBDBKF_13785 69.1 Morganella morganii S1 cof Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases
EHELCC_11455 EHELCC_11455 69.1 Morganella morganii S2 cof Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases
NLDBIP_11800 NLDBIP_11800 69.1 Morganella morganii S4 cof Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases
LHKJJB_11660 LHKJJB_11660 69.1 Morganella morganii S3 cof Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases
HKOGLL_10270 HKOGLL_10270 69.1 Morganella morganii S5 cof Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases

Distribution of the homologs in the orthogroup group_2935

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2935

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A8Y7 2.53e-30 117 27 1 263 3 yidA Sugar phosphatase YidA Shigella flexneri
P0A8Y5 2.53e-30 117 27 1 263 1 yidA Sugar phosphatase YidA Escherichia coli (strain K12)
P0A8Y6 2.53e-30 117 27 1 263 3 yidA Sugar phosphatase YidA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q5XD45 3.06e-30 117 28 2 263 1 M6_Spy0533 Putative phosphatase M6_Spy0533 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P54947 9.54e-27 108 27 1 265 3 yxeH Putative phosphatase YxeH Bacillus subtilis (strain 168)
P96741 1.65e-21 94 28 7 291 1 ywtE 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YwtE Bacillus subtilis (strain 168)
P42962 9.34e-17 80 27 8 266 1 ycsE 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YcsE Bacillus subtilis (strain 168)
P70947 2.29e-15 77 26 9 273 1 yitU 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YitU Bacillus subtilis (strain 168)
P94592 6.26e-15 76 28 8 294 1 ywpJ Phosphatase YwpJ Bacillus subtilis (strain 168)
O27143 4.89e-12 67 46 0 75 3 MTH_1071 Phosphoglycolate phosphatase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q45494 7.96e-12 67 26 9 261 3 ykrA Putative phosphatase YkrA Bacillus subtilis (strain 168)
Q8L5Z4 1.01e-10 65 26 9 272 1 YBEY Endoribonuclease YBEY, chloroplastic Arabidopsis thaliana
P75360 4.6e-09 59 24 5 251 3 MPN_427 Putative phosphatase MPN_427 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
A5ULS3 1.01e-08 57 30 1 106 3 Msm_0946 Phosphoglycolate phosphatase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
O07539 2.06e-08 57 36 0 86 1 yhaX Stress response protein YhaX Bacillus subtilis (strain 168)
A1JNL2 2.45e-08 57 25 9 270 3 cof HMP-PP phosphatase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P95931 2.71e-08 56 38 2 84 3 SSO2157 Phosphoglycolate phosphatase 2 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A4W7B7 1.22e-07 55 24 8 265 3 cof HMP-PP phosphatase Enterobacter sp. (strain 638)
Q96YM5 1.29e-07 54 36 4 87 3 STK_21470 Phosphoglycolate phosphatase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
B7MQG2 1.34e-07 55 25 10 269 3 cof HMP-PP phosphatase Escherichia coli O81 (strain ED1a)
A8AK07 1.41e-07 55 25 9 270 3 cof HMP-PP phosphatase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6T5I9 1.56e-07 54 26 10 273 3 cof HMP-PP phosphatase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y0T3 2.71e-07 53 26 11 273 3 cof HMP-PP phosphatase Klebsiella pneumoniae (strain 342)
Q32JB1 2.78e-07 52 27 1 134 5 cof Putative HMP-PP phosphatase Shigella dysenteriae serotype 1 (strain Sd197)
A8GAR8 4.4e-07 53 24 11 282 3 cof HMP-PP phosphatase Serratia proteamaculans (strain 568)
Q3Z4V2 5.06e-07 53 25 10 269 3 cof HMP-PP phosphatase Shigella sonnei (strain Ss046)
B2U4Q1 5.06e-07 53 25 10 269 3 cof HMP-PP phosphatase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RF89 5.06e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli (strain UTI89 / UPEC)
B1LJK3 5.06e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli (strain SMS-3-5 / SECEC)
B6HZQ3 5.06e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli (strain SE11)
Q0TKJ5 5.06e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A8B5 5.06e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli O1:K1 / APEC
A7ZXA4 5.06e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli O9:H4 (strain HS)
B7NJ48 5.06e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MDA5 5.06e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJR9 5.06e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZIK4 5.06e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8FKA2 5.1e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7N900 6.38e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7M3T9 6.38e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli O8 (strain IAI1)
A3CWU5 6.44e-07 52 40 1 76 3 Memar_1919 Phosphoglycolate phosphatase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
P46891 6.56e-07 53 25 10 269 1 cof HMP-PP phosphatase Escherichia coli (strain K12)
B1XFN4 6.56e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli (strain K12 / DH10B)
C4ZTK3 6.56e-07 53 25 10 269 3 cof HMP-PP phosphatase Escherichia coli (strain K12 / MC4100 / BW2952)
B5Z3V4 7.2e-07 52 24 10 269 3 cof HMP-PP phosphatase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE50 7.2e-07 52 24 10 269 3 cof HMP-PP phosphatase Escherichia coli O157:H7
B1JHR2 8.25e-07 52 24 6 266 3 cof HMP-PP phosphatase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FLB5 8.25e-07 52 24 6 266 3 cof HMP-PP phosphatase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B7LMD3 8.67e-07 52 24 9 266 3 cof HMP-PP phosphatase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q5XAQ1 1.01e-06 53 42 0 57 1 M6_Spy1377 Putative bifunctional phosphatase/peptidyl-prolyl cis-trans isomerase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A4TPD3 1.07e-06 52 24 6 266 3 cof HMP-PP phosphatase Yersinia pestis (strain Pestoides F)
Q1CL56 1.07e-06 52 24 6 266 3 cof HMP-PP phosphatase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZP3 1.07e-06 52 24 6 266 3 cof HMP-PP phosphatase Yersinia pestis bv. Antiqua (strain Angola)
Q7CK25 1.07e-06 52 24 6 266 3 cof HMP-PP phosphatase Yersinia pestis
Q1C4L7 1.07e-06 52 24 6 266 3 cof HMP-PP phosphatase Yersinia pestis bv. Antiqua (strain Antiqua)
Q325F5 1.48e-06 52 25 10 267 3 cof HMP-PP phosphatase Shigella boydii serotype 4 (strain Sb227)
Q83M49 1.79e-06 51 24 10 270 3 cof HMP-PP phosphatase Shigella flexneri
Q0T7D7 1.79e-06 51 24 10 270 3 cof HMP-PP phosphatase Shigella flexneri serotype 5b (strain 8401)
P44447 1.86e-06 51 35 0 80 1 HI_0003 Putative phosphatase HI_0003 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B1IZE7 2.05e-06 51 29 1 122 3 cof HMP-PP phosphatase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q66DS5 2.05e-06 51 24 6 266 3 cof HMP-PP phosphatase Yersinia pseudotuberculosis serotype I (strain IP32953)
B4SWV0 2.59e-06 51 24 8 266 3 cof HMP-PP phosphatase Salmonella newport (strain SL254)
Q8ZRB6 2.77e-06 51 24 8 266 3 cof HMP-PP phosphatase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BD74 2.77e-06 51 24 8 266 3 cof HMP-PP phosphatase Salmonella paratyphi A (strain AKU_12601)
A9MWC0 2.77e-06 51 24 8 266 3 cof HMP-PP phosphatase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PFM4 2.77e-06 51 24 8 266 3 cof HMP-PP phosphatase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T9F2 2.77e-06 51 24 8 266 3 cof HMP-PP phosphatase Salmonella heidelberg (strain SL476)
B5R6V8 2.77e-06 51 24 8 266 3 cof HMP-PP phosphatase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QU47 2.77e-06 51 24 8 266 3 cof HMP-PP phosphatase Salmonella enteritidis PT4 (strain P125109)
B5FKW1 2.77e-06 51 24 8 266 3 cof HMP-PP phosphatase Salmonella dublin (strain CT_02021853)
A7MFJ6 2.79e-06 51 25 7 265 3 cof HMP-PP phosphatase Cronobacter sakazakii (strain ATCC BAA-894)
P75399 3.4e-06 50 24 7 237 3 MPN_383 Putative phosphatase MPN_383 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q8Z8U7 3.69e-06 50 24 8 266 3 cof HMP-PP phosphatase Salmonella typhi
B4TMD5 4.16e-06 50 24 8 267 3 cof HMP-PP phosphatase Salmonella schwarzengrund (strain CVM19633)
B7L683 4.78e-06 50 24 10 269 3 cof HMP-PP phosphatase Escherichia coli (strain 55989 / EAEC)
B2K6W6 4.89e-06 50 28 1 120 3 cof HMP-PP phosphatase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q57SA6 5.24e-06 50 24 8 266 3 cof HMP-PP phosphatase Salmonella choleraesuis (strain SC-B67)
O50129 5.89e-06 49 33 0 77 1 PH1421 Phosphoglycolate phosphatase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
B5EXJ7 9.3e-06 49 24 8 266 3 cof HMP-PP phosphatase Salmonella agona (strain SL483)
Q5JDB7 1.03e-05 49 38 0 62 3 TK2301 Phosphoglycolate phosphatase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P21829 1.5e-05 48 27 8 278 1 ybhA Pyridoxal phosphate phosphatase YbhA Escherichia coli (strain K12)
Q8U111 2.16e-05 48 40 0 60 3 PF1419 Phosphoglycolate phosphatase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
C6A1L0 2.76e-05 47 36 0 77 3 TSIB_0439 Phosphoglycolate phosphatase Thermococcus sibiricus (strain DSM 12597 / MM 739)
O29805 3.22e-05 47 31 1 85 3 AF_0444 Phosphoglycolate phosphatase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A9MM14 5.87e-05 47 24 8 266 3 cof HMP-PP phosphatase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8TK72 7.7e-05 46 30 0 75 3 MA_3544 Phosphoglycolate phosphatase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P21878 9e-05 43 32 0 78 3 None Uncharacterized protein in pdhA 5'region (Fragment) Geobacillus stearothermophilus
Q6KZ42 0.000136 45 28 0 71 3 PTO1425 Phosphoglycolate phosphatase Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q9V0Q4 0.000186 45 33 0 74 3 PYRAB07350 Phosphoglycolate phosphatase Pyrococcus abyssi (strain GE5 / Orsay)
Q9UTA6 0.000201 45 26 5 137 1 SPAC25B8.12c Uncharacterized hydrolase C25B8.12c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9HRF9 0.000323 44 35 0 82 3 VNG_0718C Phosphoglycolate phosphatase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R403 0.000323 44 35 0 82 3 OE_2060R Phosphoglycolate phosphatase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
A9CK30 0.000375 44 32 3 95 1 mfppA Mannosylfructose-phosphate phosphatase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8TYT9 0.001 43 34 0 82 3 MK0203 Phosphoglycolate phosphatase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12655
Feature type CDS
Gene -
Product Cof-type HAD-IIB family hydrolase
Location 129280 - 130098 (strand: 1)
Length 819 (nucleotides) / 272 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000003
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2935
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF08282 haloacid dehalogenase-like hydrolase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0561 Coenzyme transport and metabolism (H)
General function prediction only (R)
HR Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases

Protein Sequence

MTTLAIDLDGTLLHPDNYISAANRQALLALPAETNIVICSARPLQPILSLLDNADLHTVIRAVGAFNGAVIYDCRTHSVLSKTTLCPAVLSQLQPVLQSIPCGWHAFTTDALLCLPGERADYTTHEAALFGLPVNTVTADELFSRADILKITLCGDAQDLALRVQTLRPELPSALRTFFTDQHYFELVPGSVSKGAVLHELTAKGIIPPGSVMAVGDQENDLSLFEAADIRVAMGNAVPALKQHADFITGTCRDDGVAAALRHFISAFRNGG

Flanking regions ( +/- flanking 50bp)

CACAACTGATTGTTATCCAATGCGGGAGCCTGCTCCCGCTGAGGTTTTTTATGACAACACTGGCTATCGATCTCGACGGCACATTACTTCATCCTGACAATTATATTTCAGCTGCAAACCGGCAGGCATTACTGGCGCTCCCGGCTGAAACCAATATTGTTATCTGTTCTGCCCGCCCGCTTCAGCCTATTCTTTCTCTGCTTGATAATGCAGACCTGCACACTGTTATCCGGGCTGTCGGGGCATTTAACGGCGCAGTTATTTATGATTGCCGCACACACTCAGTACTGAGCAAAACCACACTTTGTCCGGCTGTGTTATCTCAGTTACAACCTGTCCTGCAATCCATTCCCTGCGGCTGGCATGCATTTACCACGGATGCCCTGCTCTGCCTGCCGGGCGAACGCGCCGACTATACAACACACGAAGCCGCCCTGTTTGGTCTGCCGGTCAACACAGTGACAGCCGATGAATTATTCAGCCGCGCTGATATTCTCAAAATTACCCTGTGCGGTGATGCGCAGGATCTGGCTCTGCGGGTACAGACACTGCGCCCGGAACTGCCGTCAGCGCTGCGGACATTTTTTACCGATCAGCACTATTTTGAGCTGGTGCCGGGATCGGTCAGTAAAGGCGCGGTACTGCATGAACTGACAGCAAAAGGAATTATCCCGCCCGGATCAGTAATGGCTGTCGGCGACCAGGAAAACGATCTCTCTTTGTTTGAAGCCGCCGATATCCGGGTGGCGATGGGCAATGCCGTTCCCGCGCTGAAGCAACATGCCGATTTTATCACCGGCACCTGCCGGGATGATGGTGTTGCCGCCGCACTCCGCCATTTTATCTCCGCATTCCGCAACGGCGGATAATGCGCTAATATTGTTACTGTTTAAGGGCGCGATGAGAACAGCCATGAATC