Homologs in group_1997

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15030 FBDBKF_15030 90.4 Morganella morganii S1 rdgB RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
EHELCC_11215 EHELCC_11215 90.4 Morganella morganii S2 rdgB RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
NLDBIP_11560 NLDBIP_11560 90.4 Morganella morganii S4 rdgB RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
LHKJJB_11420 LHKJJB_11420 90.4 Morganella morganii S3 rdgB RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
HKOGLL_10030 HKOGLL_10030 90.4 Morganella morganii S5 rdgB RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
PMI_RS01590 PMI_RS01590 71.6 Proteus mirabilis HI4320 - XTP/dITP diphosphatase

Distribution of the homologs in the orthogroup group_1997

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1997

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZM45 3.11e-99 288 69 0 196 3 rdgB dITP/XTP pyrophosphatase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PMK9 3.11e-99 288 69 0 196 3 rdgB dITP/XTP pyrophosphatase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8XCU5 5.21e-99 288 68 0 196 3 rdgB dITP/XTP pyrophosphatase Escherichia coli O157:H7
Q8Z3U6 1.41e-98 286 68 0 196 3 rdgB dITP/XTP pyrophosphatase Salmonella typhi
Q83JS0 2.28e-98 286 68 0 196 3 rdgB dITP/XTP pyrophosphatase Shigella flexneri
Q8FE27 4.46e-98 285 67 0 196 3 rdgB dITP/XTP pyrophosphatase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P52061 8.31e-97 282 66 0 196 1 rdgB dITP/XTP pyrophosphatase Escherichia coli (strain K12)
Q7N7H2 9.9e-97 282 66 0 195 3 plu1177 dITP/XTP pyrophosphatase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q666N1 3.76e-95 278 68 0 195 3 YPTB3217 dITP/XTP pyrophosphatase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZHF4 8.64e-95 277 68 0 195 3 YPO0945 dITP/XTP pyrophosphatase Yersinia pestis
Q7MHJ0 1.74e-92 271 65 0 194 3 VV2879 dITP/XTP pyrophosphatase Vibrio vulnificus (strain YJ016)
Q8DCB9 1.74e-92 271 65 0 194 3 VV1_1520 dITP/XTP pyrophosphatase Vibrio vulnificus (strain CMCP6)
B2VEZ3 2.86e-92 271 65 0 196 3 ETA_28410 dITP/XTP pyrophosphatase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6LML4 2.92e-91 268 64 0 194 3 PBPRA3148 dITP/XTP pyrophosphatase Photobacterium profundum (strain SS9)
Q6D117 9.74e-91 266 67 0 184 3 ECA3631 dITP/XTP pyrophosphatase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9KUQ9 4.1e-87 258 62 0 193 3 VC_0456 dITP/XTP pyrophosphatase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87LJ1 5.57e-87 257 61 0 193 3 VP2621 dITP/XTP pyrophosphatase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B8GPB3 4.2e-79 237 60 0 193 3 Tgr7_2961 dITP/XTP pyrophosphatase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q5QY51 2.19e-74 225 59 1 195 3 IL1979 dITP/XTP pyrophosphatase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
P44598 7.55e-73 221 54 0 195 1 HI_0260 dITP/XTP pyrophosphatase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q65RQ6 3.61e-71 217 57 1 197 3 MS1747 dITP/XTP pyrophosphatase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8EBY7 4.07e-71 217 55 1 194 3 SO_3358 dITP/XTP pyrophosphatase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9CKF5 1.51e-70 216 55 1 193 3 PM1666 dITP/XTP pyrophosphatase Pasteurella multocida (strain Pm70)
Q83FA3 4.86e-70 214 51 1 196 1 CBU_0043 dITP/XTP pyrophosphatase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q87V88 6.55e-69 211 55 4 193 3 PSPTO_5051 dITP/XTP pyrophosphatase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q602P0 6.91e-69 211 53 0 196 3 MCA3023 dITP/XTP pyrophosphatase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5H3S6 1.55e-68 210 55 0 193 3 XOO1141 dITP/XTP pyrophosphatase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q88CT0 5.16e-68 209 54 4 194 3 PP_5100 dITP/XTP pyrophosphatase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A1WVN6 5.33e-68 209 55 0 192 3 Hhal_0972 dITP/XTP pyrophosphatase Halorhodospira halophila (strain DSM 244 / SL1)
Q7VLS3 6.43e-68 209 54 1 196 3 HD_1348 dITP/XTP pyrophosphatase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8PH61 1.22e-67 208 54 0 193 3 XAC3399 dITP/XTP pyrophosphatase Xanthomonas axonopodis pv. citri (strain 306)
Q8P5T3 3.34e-66 204 53 0 193 3 XCC3253 dITP/XTP pyrophosphatase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UY37 3.34e-66 204 53 0 193 3 XC_0962 dITP/XTP pyrophosphatase Xanthomonas campestris pv. campestris (strain 8004)
Q9I6A8 1.37e-65 203 53 2 192 3 PA0387 dITP/XTP pyrophosphatase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q87DG2 3.5e-65 202 53 0 195 3 PD_0723 dITP/XTP pyrophosphatase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8XXF4 6.3e-65 201 53 2 197 3 RSc2160 dITP/XTP pyrophosphatase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9PD73 2.44e-64 200 51 0 195 3 XF_1506 dITP/XTP pyrophosphatase Xylella fastidiosa (strain 9a5c)
Q6FEQ6 3.66e-64 200 54 3 195 3 ACIAD0526 dITP/XTP pyrophosphatase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q5NEQ9 1.44e-63 197 49 1 193 3 FTT_1560 dITP/XTP pyrophosphatase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q82XJ3 2e-63 197 53 1 192 3 NE0277 dITP/XTP pyrophosphatase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B2I3B3 2.26e-62 195 51 3 198 3 ACICU_00479 dITP/XTP pyrophosphatase Acinetobacter baumannii (strain ACICU)
A3M1X9 5.3e-62 194 50 3 197 3 A1S_0468 dITP/XTP pyrophosphatase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B7I4X1 8.47e-62 194 50 3 198 3 AB57_0572 dITP/XTP pyrophosphatase Acinetobacter baumannii (strain AB0057)
B7H0A1 8.47e-62 194 50 3 198 3 ABBFA_003065 dITP/XTP pyrophosphatase Acinetobacter baumannii (strain AB307-0294)
Q7VXX8 6.82e-61 191 51 2 197 3 BP1593 dITP/XTP pyrophosphatase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WI95 6.82e-61 191 51 2 197 3 BB2956 dITP/XTP pyrophosphatase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5KWI6 1.58e-60 190 53 3 192 3 GK2665 dITP/XTP pyrophosphatase Geobacillus kaustophilus (strain HTA426)
Q5ZSN3 1.86e-60 190 49 1 189 3 lpg2484 dITP/XTP pyrophosphatase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X245 3.43e-60 189 49 1 189 3 lpp2548 dITP/XTP pyrophosphatase Legionella pneumophila (strain Paris)
Q7W6C6 4.59e-60 189 51 2 197 3 BPP2990 dITP/XTP pyrophosphatase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q5WTW9 1.3e-59 187 49 1 189 3 lpl2404 dITP/XTP pyrophosphatase Legionella pneumophila (strain Lens)
Q62HZ7 6.31e-59 186 50 2 195 3 BMA2099 dITP/XTP pyrophosphatase Burkholderia mallei (strain ATCC 23344)
Q63RV4 6.69e-59 186 50 2 195 3 BPSL2566 dITP/XTP pyrophosphatase Burkholderia pseudomallei (strain K96243)
Q65GG3 4.04e-56 179 48 2 190 3 BLi02984 dITP/XTP pyrophosphatase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q9K0G6 9.11e-56 178 50 2 194 3 NMB0639 dITP/XTP pyrophosphatase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A4J7Y6 3.43e-55 177 49 3 195 3 Dred_2683 dITP/XTP pyrophosphatase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q7NZJ6 4.58e-55 176 45 1 196 3 CV_0926 dITP/XTP pyrophosphatase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8D3C3 1.23e-54 175 41 2 196 3 WIGBR0780 dITP/XTP pyrophosphatase Wigglesworthia glossinidia brevipalpis
Q817P4 2.39e-54 174 45 1 194 3 BC_4493 dITP/XTP pyrophosphatase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9JVG5 3.61e-54 174 49 2 194 3 NMA0849 dITP/XTP pyrophosphatase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q72ZT2 7.96e-54 173 45 1 194 3 BCE_4585 dITP/XTP pyrophosphatase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6HD43 1.05e-53 173 45 1 194 3 BT9727_4217 dITP/XTP pyrophosphatase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q633V5 1.05e-53 173 45 1 194 3 BCE33L4233 dITP/XTP pyrophosphatase Bacillus cereus (strain ZK / E33L)
Q81LB0 1.11e-53 173 45 1 194 3 BA_4714 dITP/XTP pyrophosphatase Bacillus anthracis
Q8XI68 2.28e-53 172 43 3 201 3 CPE2253 dITP/XTP pyrophosphatase Clostridium perfringens (strain 13 / Type A)
B2A6I7 2.47e-53 172 44 2 195 3 Nther_1950 dITP/XTP pyrophosphatase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q726F4 3.63e-52 169 50 3 196 3 DVU_3154 dITP/XTP pyrophosphatase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B1YJW5 1.01e-51 167 47 2 193 3 Exig_2151 dITP/XTP pyrophosphatase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
P94558 1.11e-51 167 47 4 197 3 ysnA dITP/XTP pyrophosphatase Bacillus subtilis (strain 168)
A1W4I7 1.08e-50 165 46 2 197 3 Ajs_0922 dITP/XTP pyrophosphatase Acidovorax sp. (strain JS42)
B9MEJ9 1.08e-50 165 46 2 197 3 Dtpsy_0857 dITP/XTP pyrophosphatase Acidovorax ebreus (strain TPSY)
Q5P5J5 1.13e-50 165 47 1 195 3 AZOSEA12920 dITP/XTP pyrophosphatase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q97FR2 1.17e-50 165 43 3 196 3 CA_C2665 dITP/XTP pyrophosphatase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A1TT41 1.87e-50 164 45 2 197 3 Aave_3578 dITP/XTP pyrophosphatase Paracidovorax citrulli (strain AAC00-1)
Q74C80 1.99e-49 162 45 3 197 3 GSU1794 dITP/XTP pyrophosphatase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q5SHS6 3.24e-49 162 47 2 195 3 TTHA1654 dITP/XTP pyrophosphatase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72I42 8.9e-49 160 46 2 195 3 TT_C1290 dITP/XTP pyrophosphatase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q8Y7N5 1.92e-48 159 45 3 189 3 lmo1239 dITP/XTP pyrophosphatase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q720J0 1.95e-48 159 45 3 189 3 LMOf2365_1248 dITP/XTP pyrophosphatase Listeria monocytogenes serotype 4b (strain F2365)
Q03YJ8 3.06e-48 159 47 5 192 3 LEUM_0610 dITP/XTP pyrophosphatase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q92CH0 6.86e-48 158 44 3 189 3 lin1202 dITP/XTP pyrophosphatase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q5FLV7 5.02e-47 156 44 4 199 3 LBA0426 dITP/XTP pyrophosphatase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B1MLZ4 1.81e-46 154 45 3 200 1 MAB_1485 dITP/XTP pyrophosphatase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
B1Y0J8 1.83e-46 155 44 2 208 3 Lcho_0704 dITP/XTP pyrophosphatase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B5YHP2 2.84e-46 154 44 4 194 3 THEYE_A1837 dITP/XTP pyrophosphatase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q73X89 4.43e-46 154 46 6 199 3 MAP_2420c dITP/XTP pyrophosphatase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q8RC29 4.58e-46 153 42 3 194 3 TTE0620 dITP/XTP pyrophosphatase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A9BTA7 5.69e-46 153 43 2 197 3 Daci_2032 dITP/XTP pyrophosphatase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q74KU4 7.22e-46 153 44 4 197 3 LJ_0483 dITP/XTP pyrophosphatase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
P74432 1.25e-45 152 47 5 189 3 slr0402 dITP/XTP pyrophosphatase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9K8D9 2.86e-45 151 41 2 190 3 BH3067 dITP/XTP pyrophosphatase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q3A2Y7 3.69e-45 151 45 2 195 3 Pcar_2029 dITP/XTP pyrophosphatase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q21XZ3 4.12e-45 151 44 2 196 3 Rfer_1630 dITP/XTP pyrophosphatase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B0KBM4 4.91e-45 150 42 4 190 3 Teth39_1682 dITP/XTP pyrophosphatase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q88V20 9.3e-45 150 42 3 191 3 lp_2267 dITP/XTP pyrophosphatase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B0K3T5 1.12e-44 150 42 4 190 3 Teth514_0552 dITP/XTP pyrophosphatase Thermoanaerobacter sp. (strain X514)
Q8EPJ6 1.98e-44 149 40 2 191 3 OB2105 dITP/XTP pyrophosphatase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5HQ23 7.81e-44 147 45 5 193 3 SERP0734 dITP/XTP pyrophosphatase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P99094 1.55e-43 147 44 5 199 1 SA0998 dITP/XTP pyrophosphatase Staphylococcus aureus (strain N315)
P64309 1.55e-43 147 44 5 199 3 SAV1152 dITP/XTP pyrophosphatase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6GHT4 1.63e-43 147 44 4 190 3 SAR1124 dITP/XTP pyrophosphatase Staphylococcus aureus (strain MRSA252)
P58995 2.1e-43 146 44 5 199 3 MW1034 dITP/XTP pyrophosphatase Staphylococcus aureus (strain MW2)
Q6GA63 2.1e-43 146 44 5 199 3 SAS1085 dITP/XTP pyrophosphatase Staphylococcus aureus (strain MSSA476)
Q5HGT2 2.1e-43 146 44 5 199 3 SACOL1162 dITP/XTP pyrophosphatase Staphylococcus aureus (strain COL)
Q8DSQ6 2.44e-43 150 44 3 193 3 SMU_1717c dITP/XTP pyrophosphatase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8CSY5 2.84e-43 146 45 5 192 3 SE_0844 dITP/XTP pyrophosphatase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8DY93 3.18e-43 150 42 3 193 3 SAG1599 dITP/XTP pyrophosphatase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E3V8 3.18e-43 150 42 3 193 3 gbs1648 dITP/XTP pyrophosphatase Streptococcus agalactiae serotype III (strain NEM316)
Q67SL4 4.4e-43 145 45 6 201 3 STH344 dITP/XTP pyrophosphatase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B8DVS6 4.68e-43 147 38 4 231 3 BLA_0275 dITP/XTP pyrophosphatase Bifidobacterium animalis subsp. lactis (strain AD011)
Q6AEL0 5.61e-43 145 45 4 195 3 Lxx13570 dITP/XTP pyrophosphatase Leifsonia xyli subsp. xyli (strain CTCB07)
A1VKF6 6.39e-43 145 44 2 197 3 Pnap_0815 dITP/XTP pyrophosphatase Polaromonas naphthalenivorans (strain CJ2)
Q8YM52 1.79e-42 144 44 4 193 3 all5088 dITP/XTP pyrophosphatase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9CG29 1.96e-42 144 40 5 200 3 ynbD dITP/XTP pyrophosphatase Lactococcus lactis subsp. lactis (strain IL1403)
Q7V4S3 2.39e-42 144 44 5 196 3 PMT_1872 dITP/XTP pyrophosphatase Prochlorococcus marinus (strain MIT 9313)
Q8F031 2.49e-42 144 39 4 199 3 LA_3666 dITP/XTP pyrophosphatase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72UV8 2.49e-42 144 39 4 199 3 LIC_10549 dITP/XTP pyrophosphatase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q6AQD7 2.82e-42 144 44 4 189 3 DP0707 dITP/XTP pyrophosphatase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B5YEU3 3.01e-42 144 40 4 202 3 DICTH_1222 dITP/XTP pyrophosphatase Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q0RQL6 8.99e-42 142 44 7 209 3 FRAAL1502 dITP/XTP pyrophosphatase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
P9WMR7 1.97e-41 142 44 4 189 1 Rv1341 dITP/XTP pyrophosphatase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMR6 1.97e-41 142 44 4 189 3 MT1382 dITP/XTP pyrophosphatase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64308 1.97e-41 142 44 4 189 3 BQ2027_MB1376 dITP/XTP pyrophosphatase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A1WQF4 2.16e-41 141 45 2 196 3 Veis_4156 dITP/XTP pyrophosphatase Verminephrobacter eiseniae (strain EF01-2)
Q7NN81 2.56e-41 141 44 5 200 3 glr0532 dITP/XTP pyrophosphatase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A2SJB9 2.83e-41 141 44 2 204 3 Mpe_A2704 dITP/XTP pyrophosphatase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
C4L4I7 3.49e-41 140 44 3 189 3 EAT1b_2634 dITP/XTP pyrophosphatase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
P0DB59 3.9e-41 144 41 3 193 3 SPs1596 dITP/XTP pyrophosphatase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DB58 3.9e-41 144 41 3 193 3 SpyM3_0263 dITP/XTP pyrophosphatase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8NMR5 3.99e-41 141 42 4 201 3 Cgl2500 dITP/XTP pyrophosphatase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q6A760 4.24e-41 140 43 6 201 3 PPA1673 dITP/XTP pyrophosphatase Cutibacterium acnes (strain DSM 16379 / KPA171202)
A4QGQ5 5.06e-41 140 42 4 201 3 cgR_2413 dITP/XTP pyrophosphatase Corynebacterium glutamicum (strain R)
Q891I4 6.01e-41 140 38 4 198 3 CTC_02388 dITP/XTP pyrophosphatase Clostridium tetani (strain Massachusetts / E88)
Q8P2D2 1.07e-40 143 41 3 193 3 spyM18_0412 dITP/XTP pyrophosphatase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5WEM4 1.35e-40 139 41 1 193 3 ABC2651 dITP/XTP pyrophosphatase Shouchella clausii (strain KSM-K16)
P52063 1.63e-40 139 44 7 203 3 ML1175 dITP/XTP pyrophosphatase Mycobacterium leprae (strain TN)
Q9A1B6 1.91e-40 142 41 3 193 3 SPy_0362 dITP/XTP pyrophosphatase Streptococcus pyogenes serotype M1
Q82D15 2.01e-40 139 43 3 196 3 SAV_5172 dITP/XTP pyrophosphatase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q5M1I4 2.28e-40 142 41 3 193 3 str0256 dITP/XTP pyrophosphatase Streptococcus thermophilus (strain CNRZ 1066)
Q5M626 2.36e-40 142 41 3 193 3 stu0256 dITP/XTP pyrophosphatase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q7UGM3 2.68e-40 139 44 5 200 3 RB5134 dITP/XTP pyrophosphatase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q2RN61 3.87e-40 138 42 3 203 3 Rru_A3640 dITP/XTP pyrophosphatase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q9S2H9 4.57e-40 138 43 3 196 3 SCO2902 dITP/XTP pyrophosphatase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8FMU9 6.69e-40 138 41 3 202 3 CE2400 dITP/XTP pyrophosphatase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A0LG38 6.87e-40 139 47 4 188 3 Sfum_0691 dITP/XTP pyrophosphatase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q5XDP8 9.67e-40 141 41 3 193 3 M6_Spy0330 dITP/XTP pyrophosphatase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q6NFN7 1.29e-39 137 41 4 199 3 DIP1850 dITP/XTP pyrophosphatase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q46H95 1.9e-39 136 43 5 193 3 PMN2A_1645 dITP/XTP pyrophosphatase Prochlorococcus marinus (strain NATL2A)
A2C0B3 1.9e-39 136 43 5 193 3 NATL1_03591 dITP/XTP pyrophosphatase Prochlorococcus marinus (strain NATL1A)
O66580 2.45e-39 136 41 6 204 3 aq_202 dITP/XTP pyrophosphatase Aquifex aeolicus (strain VF5)
Q7U9M0 6.4e-39 135 45 5 195 3 SYNW0234 dITP/XTP pyrophosphatase Parasynechococcus marenigrum (strain WH8102)
Q73KE7 8.7e-39 134 42 4 188 3 TDE_2271 dITP/XTP pyrophosphatase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q8DHZ6 8.89e-39 134 43 4 192 3 tll1797 dITP/XTP pyrophosphatase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P64311 1.61e-38 134 39 3 193 3 spr1695 dITP/XTP pyrophosphatase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P64310 1.61e-38 134 39 3 193 3 SP_1880 dITP/XTP pyrophosphatase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B2KEA9 3.32e-38 133 43 3 190 3 Emin_1305 dITP/XTP pyrophosphatase Elusimicrobium minutum (strain Pei191)
Q4JX01 5.35e-38 133 40 5 211 3 jk0499 dITP/XTP pyrophosphatase Corynebacterium jeikeium (strain K411)
Q5Z0V0 1.27e-37 132 43 3 189 3 NFA_10960 dITP/XTP pyrophosphatase Nocardia farcinica (strain IFM 10152)
B9L638 1.37e-37 131 39 7 201 3 NAMH_1434 dITP/XTP pyrophosphatase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
B0SE38 8.2e-37 129 37 7 204 3 LBF_2585 dITP/XTP pyrophosphatase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A6Q6L9 9.22e-37 130 40 5 205 3 SUN_0168 dITP/XTP pyrophosphatase Sulfurovum sp. (strain NBC37-1)
Q64MG2 1.42e-36 129 39 5 199 3 BF4588 dITP/XTP pyrophosphatase Bacteroides fragilis (strain YCH46)
B2V8P5 2.58e-36 129 40 6 208 3 SYO3AOP1_0682 dITP/XTP pyrophosphatase Sulfurihydrogenibium sp. (strain YO3AOP1)
Q0IDG4 9.03e-36 127 42 4 187 3 sync_0272 dITP/XTP pyrophosphatase Synechococcus sp. (strain CC9311)
Q6G1E6 1.81e-35 127 40 7 209 3 BQ00480 dITP/XTP pyrophosphatase Bartonella quintana (strain Toulouse)
Q9ABS4 2.02e-35 126 41 5 196 3 CC_0146 dITP/XTP pyrophosphatase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B3DTK7 2.15e-35 127 36 6 247 3 BLD_1030 dITP/XTP pyrophosphatase Bifidobacterium longum (strain DJO10A)
B1VGW8 2.49e-35 126 39 5 204 3 cu1465 dITP/XTP pyrophosphatase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
A0M0C9 2.94e-35 125 39 5 194 3 GFO_1100 dITP/XTP pyrophosphatase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q7VDQ7 5.47e-35 125 38 3 194 3 Pro_0311 dITP/XTP pyrophosphatase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q8G7I1 1.16e-34 125 36 6 247 3 BL0285 dITP/XTP pyrophosphatase Bifidobacterium longum (strain NCC 2705)
A7HFW2 2.5e-34 124 39 6 225 3 Anae109_3424 dITP/XTP pyrophosphatase Anaeromyxobacter sp. (strain Fw109-5)
Q5NRL7 3.86e-34 123 40 3 192 3 ZMO0013 dITP/XTP pyrophosphatase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8A327 1.15e-33 121 38 5 198 3 BT_3128 dITP/XTP pyrophosphatase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q6G565 1.93e-33 121 39 5 210 3 BH00540 dITP/XTP pyrophosphatase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q1IW81 2.52e-33 120 44 4 195 3 Dgeo_2209 dITP/XTP pyrophosphatase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
A6H0L2 2.56e-33 120 36 4 195 3 FP1819 dITP/XTP pyrophosphatase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q92SK4 5.23e-33 120 37 4 207 3 R00374 dITP/XTP pyrophosphatase Rhizobium meliloti (strain 1021)
Q98DN4 9.17e-33 120 38 4 206 3 mlr4626 dITP/XTP pyrophosphatase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q5LWF7 1e-32 119 40 5 199 3 SPO0007 dITP/XTP pyrophosphatase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5HT36 1.41e-32 119 38 6 205 3 CJE1566 dITP/XTP pyrophosphatase Campylobacter jejuni (strain RM1221)
A5FH89 1.9e-32 118 37 4 193 3 Fjoh_2403 dITP/XTP pyrophosphatase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
A1W0Z2 2.8e-32 118 38 6 205 3 CJJ81176_1377 dITP/XTP pyrophosphatase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PMS6 2.8e-32 118 38 6 205 1 Cj1374c dITP/XTP pyrophosphatase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A0RMP5 3.9e-32 118 40 7 197 3 CFF8240_0274 dITP/XTP pyrophosphatase Campylobacter fetus subsp. fetus (strain 82-40)
B7GN27 6.51e-32 119 35 6 247 3 Blon_0412 dITP/XTP pyrophosphatase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q7V316 6.54e-32 117 39 3 193 3 PMM0279 dITP/XTP pyrophosphatase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
B6IVK5 8.59e-32 117 44 5 191 3 RC1_2961 dITP/XTP pyrophosphatase Rhodospirillum centenum (strain ATCC 51521 / SW)
Q7MUC6 1.43e-31 116 39 6 194 3 PG_1603 dITP/XTP pyrophosphatase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
P64306 1.72e-31 117 36 4 208 3 BR0175 dITP/XTP pyrophosphatase Brucella suis biovar 1 (strain 1330)
P64305 1.72e-31 117 36 4 208 3 BMEI1772 dITP/XTP pyrophosphatase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2IEX2 1.84e-31 117 36 5 228 3 Adeh_3360 dITP/XTP pyrophosphatase Anaeromyxobacter dehalogenans (strain 2CP-C)
A7H1W5 2.16e-31 115 38 6 205 3 JJD26997_0276 dITP/XTP pyrophosphatase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q30UH9 2.17e-31 115 37 3 194 3 Suden_0071 dITP/XTP pyrophosphatase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A7ZBP3 2.26e-31 116 38 8 214 3 Ccon26_02910 dITP/XTP pyrophosphatase Campylobacter concisus (strain 13826)
A8FN54 2.38e-31 115 38 6 205 3 C8J_1293 dITP/XTP pyrophosphatase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
C1CXX6 3.67e-31 115 42 5 199 3 Deide_19360 dITP/XTP pyrophosphatase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
A6Q5H7 6.53e-31 114 39 5 192 3 NIS_1630 dITP/XTP pyrophosphatase Nitratiruptor sp. (strain SB155-2)
A6LGA4 7.84e-31 114 34 4 195 3 BDI_3010 dITP/XTP pyrophosphatase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q8EVN6 1.01e-29 111 32 3 199 3 MYPE5240 dITP/XTP pyrophosphatase Malacoplasma penetrans (strain HF-2)
Q6MF40 3.81e-29 110 37 7 203 3 pc0085 dITP/XTP pyrophosphatase Protochlamydia amoebophila (strain UWE25)
Q8KFJ6 3.81e-29 110 39 7 209 3 CT0330 dITP/XTP pyrophosphatase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q83FT2 5.18e-29 109 37 4 194 3 TWT_621 dITP/XTP pyrophosphatase Tropheryma whipplei (strain Twist)
Q83HF7 6.08e-29 109 37 5 194 3 TW639 dITP/XTP pyrophosphatase Tropheryma whipplei (strain TW08/27)
C1F8I0 6.26e-29 109 38 7 207 3 ACP_0104 dITP/XTP pyrophosphatase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
A7HZE0 9.71e-29 109 35 7 206 3 CHAB381_0009 dITP/XTP pyrophosphatase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B1ZXD5 1e-28 109 39 6 201 3 Oter_3653 dITP/XTP pyrophosphatase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
A8ESC9 1.12e-28 108 37 5 201 3 Abu_0586 dITP/XTP pyrophosphatase Aliarcobacter butzleri (strain RM4018)
B3DV19 1.17e-28 108 36 5 188 3 Minf_1117 dITP/XTP pyrophosphatase Methylacidiphilum infernorum (isolate V4)
A5E8I8 1.23e-28 109 40 5 204 3 BBta_0185 dITP/XTP pyrophosphatase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q8UIG9 2.22e-28 108 36 5 208 3 Atu0326 dITP/XTP pyrophosphatase Agrobacterium fabrum (strain C58 / ATCC 33970)
A9NGK2 3.87e-28 107 38 3 190 3 ACL_0869 dITP/XTP pyrophosphatase Acholeplasma laidlawii (strain PG-8A)
Q5FRF4 1.65e-27 106 42 5 190 3 GOX1281 dITP/XTP pyrophosphatase Gluconobacter oxydans (strain 621H)
Q6MJR8 2.16e-27 105 37 6 197 3 Bd2701 dITP/XTP pyrophosphatase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q6NCY9 2.41e-27 105 40 6 205 3 RPA0328 dITP/XTP pyrophosphatase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q7MR19 3.02e-27 105 37 6 203 3 WS1795 dITP/XTP pyrophosphatase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q8TV07 1.51e-26 103 37 5 194 3 MK1594 dITP/XTP pyrophosphatase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q89WK5 2.93e-26 103 38 4 203 3 bll0673 dITP/XTP pyrophosphatase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B2S334 7.02e-26 103 38 7 197 3 TPASS_0438 dITP/XTP pyrophosphatase Treponema pallidum subsp. pallidum (strain SS14)
O83452 7.02e-26 103 38 7 197 3 TP_0438 dITP/XTP pyrophosphatase Treponema pallidum (strain Nichols)
Q9RXX6 6.16e-25 99 45 8 183 3 DR_0179 dITP/XTP pyrophosphatase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
B0BA59 1.88e-24 98 35 5 193 3 CTLon_0863 dITP/XTP pyrophosphatase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B8I0 1.88e-24 98 35 5 193 3 CTL0869 dITP/XTP pyrophosphatase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
O84611 3.96e-24 97 35 5 193 3 CT_606 dITP/XTP pyrophosphatase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KL90 3.96e-24 97 35 5 193 3 CTA_0658 dITP/XTP pyrophosphatase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q821F9 4.77e-24 97 34 4 197 3 CCA_00982 dITP/XTP pyrophosphatase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
A5IKR2 2.46e-23 95 35 9 197 3 Tpet_0766 dITP/XTP pyrophosphatase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9WY06 2.46e-23 95 35 9 197 1 TM_0159 dITP/XTP pyrophosphatase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q8TJS1 7.79e-23 93 35 6 190 3 MA_3706 dITP/XTP pyrophosphatase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q9PJD4 1.02e-22 94 34 6 199 3 TC_0895 dITP/XTP pyrophosphatase Chlamydia muridarum (strain MoPn / Nigg)
Q5L4Q6 1.13e-22 93 33 5 199 3 CAB952 dITP/XTP pyrophosphatase Chlamydia abortus (strain DSM 27085 / S26/3)
B4U8R9 1.36e-22 93 33 8 214 3 HY04AAS1_0843 dITP/XTP pyrophosphatase Hydrogenobaculum sp. (strain Y04AAS1)
Q9Z7D1 3.29e-22 92 33 5 199 3 CPn_0775 dITP/XTP pyrophosphatase Chlamydia pneumoniae
Q5JEX8 3.73e-22 91 34 6 195 3 TK2111 dITP/XTP pyrophosphatase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q8PZ91 1e-21 90 35 7 196 3 MM_0603 dITP/XTP pyrophosphatase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q256I5 1.7e-21 90 31 4 197 3 CF0031 dITP/XTP pyrophosphatase Chlamydia felis (strain Fe/C-56)
Q662B8 1.94e-21 90 32 9 212 3 BG0249 dITP/XTP pyrophosphatase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q6MT00 7.05e-21 89 30 3 199 3 MSC_0616 dITP/XTP pyrophosphatase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q0SNR4 1e-20 88 31 9 212 3 BAPKO_0256 dITP/XTP pyrophosphatase Borreliella afzelii (strain PKo)
O59580 3.94e-20 86 31 9 202 1 PH1917 dITP/XTP pyrophosphatase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8U446 3.98e-20 86 31 6 192 3 PF0249 dITP/XTP pyrophosphatase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
A8A8W1 6.93e-20 85 33 6 192 3 Igni_0179 dITP/XTP pyrophosphatase Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
B5RL72 1.25e-19 85 31 8 197 3 BDU_248 dITP/XTP pyrophosphatase Borrelia duttonii (strain Ly)
O28046 3.61e-19 84 31 5 193 1 AF_2237 dITP/XTP pyrophosphatase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
B5RR63 4.85e-19 84 30 8 197 3 BRE_247 dITP/XTP pyrophosphatase Borrelia recurrentis (strain A1)
Q5KPF3 5.98e-19 83 34 7 190 3 CNA03000 Inosine triphosphate pyrophosphatase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
A2BJY7 6.64e-19 83 36 9 202 3 Hbut_0432 dITP/XTP pyrophosphatase Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
Q7VF43 4.18e-18 82 31 8 238 3 HH_1835 dITP/XTP pyrophosphatase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B7J1H5 4.74e-18 81 30 8 197 3 BbuZS7_0252 dITP/XTP pyrophosphatase Borreliella burgdorferi (strain ZS7)
O51263 4.74e-18 81 30 8 197 3 BB_0247 dITP/XTP pyrophosphatase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q4DBX5 2.55e-17 79 32 7 192 3 Tc00.1047053504103.6 Inosine triphosphate pyrophosphatase 1 Trypanosoma cruzi (strain CL Brener)
A8NZ80 7.18e-17 78 34 6 196 3 CC1G_08181 Inosine triphosphate pyrophosphatase Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003)
Q4DRX4 9.14e-17 77 32 7 192 3 Tc00.1047053508307.184 Inosine triphosphate pyrophosphatase 2 Trypanosoma cruzi (strain CL Brener)
E3KAB5 1.42e-16 77 31 7 195 3 PGTG_06893 Inosine triphosphate pyrophosphatase Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL)
Q57679 1.54e-15 74 31 6 187 1 MJ0226 dITP/XTP pyrophosphatase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9VMW7 7.13e-15 72 30 5 191 2 CG8891 Inosine triphosphate pyrophosphatase Drosophila melanogaster
Q4WTN9 7.19e-15 72 31 8 196 3 AFUA_5G05560 Inosine triphosphate pyrophosphatase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q8ZVB5 1.49e-14 71 32 5 197 3 PAE2365 dITP/XTP pyrophosphatase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
F4P9L8 2.2e-14 71 29 6 196 3 BATDEDRAFT_13412 Inosine triphosphate pyrophosphatase Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211)
B2B5Q3 3.74e-14 70 31 7 194 3 Pa_2_5430 Inosine triphosphate pyrophosphatase Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383)
C8V9B7 4.24e-14 70 32 7 193 3 AN8861 Inosine triphosphate pyrophosphatase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B1L6T7 5.05e-14 70 31 7 193 3 Kcr_1420 dITP/XTP pyrophosphatase Korarchaeum cryptofilum (strain OPF8)
Q2TX99 5.23e-14 70 30 7 194 3 AO090010000228 Inosine triphosphate pyrophosphatase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q54LQ6 1.51e-13 69 29 6 200 3 itpa Inosine triphosphate pyrophosphatase Dictyostelium discoideum
Q6CDL9 2.32e-13 68 31 5 187 3 HAM1 Inosine triphosphate pyrophosphatase Yarrowia lipolytica (strain CLIB 122 / E 150)
D9PYS9 3.52e-13 68 28 5 185 3 MTBMA_c00120 dITP/XTP pyrophosphatase Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
D0MY11 5.19e-13 67 29 5 187 3 PITG_03601 Inosine triphosphate pyrophosphatase Phytophthora infestans (strain T30-4)
Q9HLA4 7.55e-13 67 34 6 139 3 Ta0325 dITP/XTP pyrophosphatase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q9KDQ1 1.51e-12 66 37 4 125 3 BH1160 Non-canonical purine NTP pyrophosphatase homolog Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
E0VVF6 1.54e-12 66 30 8 197 3 Phum_PHUM462900 Inosine triphosphate pyrophosphatase Pediculus humanus subsp. corporis
B0XL39 5.5e-12 65 30 6 192 3 CPIJ019949 Inosine triphosphate pyrophosphatase Culex quinquefasciatus
D5GCI8 8.57e-12 64 28 8 200 3 GSTUM_00005907001 Inosine triphosphate pyrophosphatase Tuber melanosporum (strain Mel28)
A7RWC9 1.47e-11 63 28 5 192 3 v1g163483 Inosine triphosphate pyrophosphatase Nematostella vectensis
Q7Q4F5 1.71e-11 63 30 5 193 3 AGAP008374 Inosine triphosphate pyrophosphatase Anopheles gambiae
Q2NLA8 1.86e-11 63 31 6 187 2 itpa Inosine triphosphate pyrophosphatase Xenopus laevis
A8XZP2 2.13e-11 63 29 8 195 3 hap-1 Inosine triphosphate pyrophosphatase Caenorhabditis briggsae
C7YTE3 3.15e-11 62 30 7 190 3 NECHADRAFT_105230 Inosine triphosphate pyrophosphatase Fusarium vanettenii (strain ATCC MYA-4622 / CBS 123669 / FGSC 9596 / NRRL 45880 / 77-13-4)
Q4PD06 4.11e-11 62 31 5 191 3 UMAG_02007 Inosine triphosphate pyrophosphatase Ustilago maydis (strain 521 / FGSC 9021)
A8BKZ6 4.13e-11 62 28 5 183 3 GL50803_7511 Inosine triphosphate pyrophosphatase Giardia intestinalis (strain ATCC 50803 / WB clone C6)
Q6L1H9 5.32e-11 62 27 5 194 3 PTO0588 dITP/XTP pyrophosphatase Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q9GYG4 8.24e-11 61 26 6 195 2 hap-1 Inosine triphosphate pyrophosphatase Caenorhabditis elegans
Q6CV82 1.51e-10 61 29 8 202 3 HAM1 Inosine triphosphate pyrophosphatase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
F1NLH9 1.62e-10 61 27 5 191 3 ITPA Inosine triphosphate pyrophosphatase Gallus gallus
C0NE84 1.95e-10 60 30 8 195 3 HCBG_02177 Inosine triphosphate pyrophosphatase Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432)
Q16YB3 2.48e-10 60 28 6 191 3 AAEL008605 Inosine triphosphate pyrophosphatase Aedes aegypti
Q97ZZ0 3.99e-10 60 35 5 130 3 SSO0432 dITP/XTP pyrophosphatase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
B6TNW8 5.43e-10 59 29 6 193 2 None Inosine triphosphate pyrophosphatase Zea mays
A3LVK6 8.43e-10 58 27 6 200 3 HAM1 Inosine triphosphate pyrophosphatase Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
E3QBC5 1.03e-09 58 31 9 189 3 GLRG_03307 Inosine triphosphate pyrophosphatase Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212)
B8BH95 1.26e-09 58 27 5 193 3 OsI_33887 Inosine triphosphate pyrophosphatase Oryza sativa subsp. indica
Q7XDP2 1.27e-09 58 27 5 193 2 Os10g0457500 Inosine triphosphate pyrophosphatase Oryza sativa subsp. japonica
C5WZH0 1.28e-09 58 29 7 193 2 Sb01g020160 Inosine triphosphate pyrophosphatase Sorghum bicolor
F6HS55 1.44e-09 58 28 6 191 2 VIT_05s0051g00580 Inosine triphosphate pyrophosphatase Vitis vinifera
Q4Q0V1 2e-09 58 26 9 221 3 LMJF_36_4630 Inosine triphosphate pyrophosphatase Leishmania major
Q8L968 2.47e-09 58 28 6 191 2 At4g13720 Inosine triphosphate pyrophosphatase Arabidopsis thaliana
F6Y089 2.89e-09 57 27 6 196 3 None Inosine triphosphate pyrophosphatase Ciona intestinalis
Q752Z9 7.21e-09 56 28 7 197 3 HAM1 Inosine triphosphate pyrophosphatase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q9D892 1.13e-08 56 27 4 191 1 Itpa Inosine triphosphate pyrophosphatase Mus musculus
D3ZW55 2.7e-08 55 28 6 192 3 Itpa Inosine triphosphate pyrophosphatase Rattus norvegicus
Q2KIC5 3.88e-08 54 27 6 196 2 ITPA Inosine triphosphate pyrophosphatase Bos taurus
Q2GW61 4.33e-08 54 31 9 188 3 CHGG_07793 Inosine triphosphate pyrophosphatase Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
A4R1J6 5.15e-08 53 31 9 190 3 MGG_06911 Inosine triphosphate pyrophosphatase Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q6BIT7 8.19e-08 53 26 6 199 3 HAM1 Inosine triphosphate pyrophosphatase Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q1K4R6 1.05e-07 53 30 8 196 3 B20D17.150 Inosine triphosphate pyrophosphatase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A5WVX0 1.12e-07 53 26 5 191 2 itpa Inosine triphosphate pyrophosphatase Danio rerio
C1FI13 1.58e-07 52 27 5 191 3 MICPUN_61716 Inosine triphosphate pyrophosphatase Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709)
Q9BY32 2.85e-07 52 29 9 194 1 ITPA Inosine triphosphate pyrophosphatase Homo sapiens
A9VE54 3.56e-07 52 26 5 187 3 13033 Inosine triphosphate pyrophosphatase Monosiga brevicollis
C4YRQ5 7.77e-07 50 26 7 202 3 HAM1 Inosine triphosphate pyrophosphatase Candida albicans (strain WO-1)
Q59N80 7.77e-07 50 26 7 202 3 HAM1 Inosine triphosphate pyrophosphatase Candida albicans (strain SC5314 / ATCC MYA-2876)
P47119 3.12e-06 49 26 7 201 1 HAM1 Inosine triphosphate pyrophosphatase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9UU89 1.71e-05 47 23 6 198 3 SPCC830.10 Inosine triphosphate pyrophosphatase Schizosaccharomyces pombe (strain 972 / ATCC 24843)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12420
Feature type CDS
Gene rdgB
Product RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
Location 67700 - 68296 (strand: 1)
Length 597 (nucleotides) / 198 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1997
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01725 Ham1 family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0127 Nucleotide transport and metabolism (F) F Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01519 XTP/dITP diphosphohydrolase [EC:3.6.1.66] Purine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Nucleotide metabolism		 -

Protein Sequence

MSRKIVLATGNAGKVREMASLLAAVGMDVVAQTELGVGPVEETGLTFVENAIIKARYAAKVTGLAAIADDSGISVDYLGGAPGIYSARYAGQDGNDGANMVKLLNALDGVPAEQRQAQFNCVLVYMRHESDPTPIICHGRWHGMIAEQAQGDGGFGYDPVFWLPELNKTAAQLRPEEKQAISHRGHALTLLLEALRNG

Flanking regions ( +/- flanking 50bp)

ATCTCTACAGCGATATCGTTCAGTGGGTACTTCTCTGATCAGGTTGTGATATGAGCCGGAAAATTGTTTTAGCTACCGGAAATGCCGGAAAAGTGCGCGAAATGGCGTCATTACTGGCAGCGGTTGGTATGGATGTGGTTGCGCAGACTGAACTGGGAGTGGGTCCGGTTGAAGAAACCGGACTGACCTTTGTTGAAAATGCCATTATCAAAGCCCGTTATGCCGCAAAAGTGACAGGATTAGCGGCGATCGCCGATGATTCCGGCATTTCGGTGGATTATCTCGGCGGTGCGCCGGGGATCTACTCTGCCCGCTATGCAGGACAGGATGGCAACGACGGTGCCAATATGGTGAAATTGCTGAATGCCCTTGACGGTGTTCCCGCAGAGCAACGTCAGGCGCAGTTTAACTGTGTACTGGTGTATATGCGCCATGAATCAGACCCGACACCCATTATTTGTCACGGACGCTGGCACGGGATGATTGCAGAACAGGCACAGGGCGACGGCGGTTTTGGCTATGACCCCGTTTTCTGGTTACCGGAACTGAACAAAACAGCGGCACAGTTGCGCCCGGAAGAGAAACAGGCAATATCTCACCGCGGCCATGCGCTGACACTGCTGCTGGAAGCCCTGCGCAATGGATAAGCTTCCTCCGCTCAGTCTGTATATCCATATTCCGTGGTGTGTTCAGAAGT