Homologs in group_1997

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_11215 EHELCC_11215 100.0 Morganella morganii S2 rdgB RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
NLDBIP_11560 NLDBIP_11560 100.0 Morganella morganii S4 rdgB RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
LHKJJB_11420 LHKJJB_11420 100.0 Morganella morganii S3 rdgB RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
HKOGLL_10030 HKOGLL_10030 100.0 Morganella morganii S5 rdgB RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
F4V73_RS12420 F4V73_RS12420 90.4 Morganella psychrotolerans rdgB RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
PMI_RS01590 PMI_RS01590 73.1 Proteus mirabilis HI4320 - XTP/dITP diphosphatase

Distribution of the homologs in the orthogroup group_1997

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1997

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8XCU5 5.22e-101 293 70 0 196 3 rdgB dITP/XTP pyrophosphatase Escherichia coli O157:H7
Q8ZM45 1.31e-100 291 70 0 196 3 rdgB dITP/XTP pyrophosphatase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PMK9 1.31e-100 291 70 0 196 3 rdgB dITP/XTP pyrophosphatase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q83JS0 2.42e-100 291 69 0 196 3 rdgB dITP/XTP pyrophosphatase Shigella flexneri
Q8FE27 4.52e-100 290 69 0 196 3 rdgB dITP/XTP pyrophosphatase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8Z3U6 5.05e-100 290 70 0 196 3 rdgB dITP/XTP pyrophosphatase Salmonella typhi
P52061 7.64e-99 287 68 0 196 1 rdgB dITP/XTP pyrophosphatase Escherichia coli (strain K12)
Q666N1 9.2e-99 287 70 0 195 3 YPTB3217 dITP/XTP pyrophosphatase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZHF4 6.54e-98 285 70 0 195 3 YPO0945 dITP/XTP pyrophosphatase Yersinia pestis
Q7N7H2 2.72e-97 283 67 0 195 3 plu1177 dITP/XTP pyrophosphatase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6LML4 2.99e-96 280 68 0 194 3 PBPRA3148 dITP/XTP pyrophosphatase Photobacterium profundum (strain SS9)
B2VEZ3 5.45e-95 278 67 0 196 3 ETA_28410 dITP/XTP pyrophosphatase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6D117 6.5e-95 277 69 0 184 3 ECA3631 dITP/XTP pyrophosphatase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7MHJ0 3.23e-94 275 67 0 194 3 VV2879 dITP/XTP pyrophosphatase Vibrio vulnificus (strain YJ016)
Q8DCB9 3.23e-94 275 67 0 194 3 VV1_1520 dITP/XTP pyrophosphatase Vibrio vulnificus (strain CMCP6)
Q87LJ1 4.93e-93 273 66 0 189 3 VP2621 dITP/XTP pyrophosphatase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KUQ9 6.42e-90 265 64 0 193 3 VC_0456 dITP/XTP pyrophosphatase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B8GPB3 1.25e-79 238 60 0 193 3 Tgr7_2961 dITP/XTP pyrophosphatase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q5QY51 4.07e-77 232 61 1 195 3 IL1979 dITP/XTP pyrophosphatase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
P44598 6.47e-76 229 56 0 195 1 HI_0260 dITP/XTP pyrophosphatase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q65RQ6 1.03e-74 226 58 1 197 3 MS1747 dITP/XTP pyrophosphatase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q83FA3 1.21e-74 226 54 0 192 1 CBU_0043 dITP/XTP pyrophosphatase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q602P0 1.53e-73 223 56 0 196 3 MCA3023 dITP/XTP pyrophosphatase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9CKF5 4.14e-73 222 56 1 197 3 PM1666 dITP/XTP pyrophosphatase Pasteurella multocida (strain Pm70)
A1WVN6 1.01e-71 218 57 0 192 3 Hhal_0972 dITP/XTP pyrophosphatase Halorhodospira halophila (strain DSM 244 / SL1)
Q8P5T3 7.78e-70 214 55 0 193 3 XCC3253 dITP/XTP pyrophosphatase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UY37 7.78e-70 214 55 0 193 3 XC_0962 dITP/XTP pyrophosphatase Xanthomonas campestris pv. campestris (strain 8004)
Q8PH61 3.36e-69 212 56 0 193 3 XAC3399 dITP/XTP pyrophosphatase Xanthomonas axonopodis pv. citri (strain 306)
Q88CT0 3.75e-69 212 53 2 193 3 PP_5100 dITP/XTP pyrophosphatase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q5H3S6 4.05e-69 212 55 0 193 3 XOO1141 dITP/XTP pyrophosphatase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q8EBY7 6.46e-69 211 54 1 194 3 SO_3358 dITP/XTP pyrophosphatase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q87V88 8.43e-69 211 53 2 192 3 PSPTO_5051 dITP/XTP pyrophosphatase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q7VLS3 8.9e-69 211 54 0 192 3 HD_1348 dITP/XTP pyrophosphatase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9I6A8 1.25e-68 211 54 2 192 3 PA0387 dITP/XTP pyrophosphatase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q87DG2 2.07e-67 207 53 0 195 3 PD_0723 dITP/XTP pyrophosphatase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8XXF4 2.28e-67 207 55 2 197 3 RSc2160 dITP/XTP pyrophosphatase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9PD73 1.12e-66 206 52 0 195 3 XF_1506 dITP/XTP pyrophosphatase Xylella fastidiosa (strain 9a5c)
Q82XJ3 4.89e-66 204 54 1 192 3 NE0277 dITP/XTP pyrophosphatase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q6FEQ6 2.26e-65 203 53 2 195 3 ACIAD0526 dITP/XTP pyrophosphatase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q5NEQ9 9.49e-65 201 50 1 193 3 FTT_1560 dITP/XTP pyrophosphatase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q63RV4 4.86e-63 197 53 2 191 3 BPSL2566 dITP/XTP pyrophosphatase Burkholderia pseudomallei (strain K96243)
Q62HZ7 4.9e-63 197 53 2 191 3 BMA2099 dITP/XTP pyrophosphatase Burkholderia mallei (strain ATCC 23344)
Q5ZSN3 6.4e-62 193 50 1 186 3 lpg2484 dITP/XTP pyrophosphatase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5WTW9 1.07e-61 193 50 1 186 3 lpl2404 dITP/XTP pyrophosphatase Legionella pneumophila (strain Lens)
Q5X245 2.67e-61 192 49 1 193 3 lpp2548 dITP/XTP pyrophosphatase Legionella pneumophila (strain Paris)
B2I3B3 3.1e-61 192 50 3 198 3 ACICU_00479 dITP/XTP pyrophosphatase Acinetobacter baumannii (strain ACICU)
A3M1X9 4.65e-61 192 50 3 197 3 A1S_0468 dITP/XTP pyrophosphatase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q7VXX8 5.61e-61 192 52 3 200 3 BP1593 dITP/XTP pyrophosphatase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WI95 5.61e-61 192 52 3 200 3 BB2956 dITP/XTP pyrophosphatase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B7I4X1 1.1e-60 191 50 3 198 3 AB57_0572 dITP/XTP pyrophosphatase Acinetobacter baumannii (strain AB0057)
B7H0A1 1.1e-60 191 50 3 198 3 ABBFA_003065 dITP/XTP pyrophosphatase Acinetobacter baumannii (strain AB307-0294)
Q7W6C6 4.5e-60 189 52 3 200 3 BPP2990 dITP/XTP pyrophosphatase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q5KWI6 6.46e-60 189 53 3 192 3 GK2665 dITP/XTP pyrophosphatase Geobacillus kaustophilus (strain HTA426)
Q7NZJ6 3.3e-58 184 48 1 196 3 CV_0926 dITP/XTP pyrophosphatase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9K0G6 7.62e-58 183 51 2 194 3 NMB0639 dITP/XTP pyrophosphatase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVG5 6.59e-57 181 52 4 198 3 NMA0849 dITP/XTP pyrophosphatase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q8D3C3 8.02e-57 181 42 2 196 3 WIGBR0780 dITP/XTP pyrophosphatase Wigglesworthia glossinidia brevipalpis
A4J7Y6 5.16e-54 174 50 3 195 3 Dred_2683 dITP/XTP pyrophosphatase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q817P4 5.7e-54 174 45 1 194 3 BC_4493 dITP/XTP pyrophosphatase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q65GG3 3.9e-53 171 46 2 194 3 BLi02984 dITP/XTP pyrophosphatase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q72ZT2 5.58e-53 171 45 1 194 3 BCE_4585 dITP/XTP pyrophosphatase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6HD43 6.05e-53 171 45 1 194 3 BT9727_4217 dITP/XTP pyrophosphatase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q633V5 6.05e-53 171 45 1 194 3 BCE33L4233 dITP/XTP pyrophosphatase Bacillus cereus (strain ZK / E33L)
Q81LB0 7.33e-53 171 45 1 194 3 BA_4714 dITP/XTP pyrophosphatase Bacillus anthracis
Q8XI68 1.12e-52 170 43 3 201 3 CPE2253 dITP/XTP pyrophosphatase Clostridium perfringens (strain 13 / Type A)
B2A6I7 4.38e-52 169 45 3 189 3 Nther_1950 dITP/XTP pyrophosphatase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
A1TT41 1.26e-51 167 47 3 197 3 Aave_3578 dITP/XTP pyrophosphatase Paracidovorax citrulli (strain AAC00-1)
P94558 1.57e-51 167 46 3 197 3 ysnA dITP/XTP pyrophosphatase Bacillus subtilis (strain 168)
Q5P5J5 5.56e-51 166 48 1 188 3 AZOSEA12920 dITP/XTP pyrophosphatase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1W4I7 5.71e-51 166 46 2 197 3 Ajs_0922 dITP/XTP pyrophosphatase Acidovorax sp. (strain JS42)
B9MEJ9 5.71e-51 166 46 2 197 3 Dtpsy_0857 dITP/XTP pyrophosphatase Acidovorax ebreus (strain TPSY)
Q97FR2 3.05e-49 161 42 3 196 3 CA_C2665 dITP/XTP pyrophosphatase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B1Y0J8 4.57e-49 161 47 2 198 3 Lcho_0704 dITP/XTP pyrophosphatase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q726F4 2.05e-48 159 48 4 201 3 DVU_3154 dITP/XTP pyrophosphatase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q5SHS6 3.28e-48 159 47 2 195 3 TTHA1654 dITP/XTP pyrophosphatase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q03YJ8 5.43e-48 158 46 5 196 3 LEUM_0610 dITP/XTP pyrophosphatase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q74C80 5.65e-48 158 46 4 200 3 GSU1794 dITP/XTP pyrophosphatase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q92CH0 8.81e-48 158 44 2 193 3 lin1202 dITP/XTP pyrophosphatase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q72I42 1.26e-47 157 46 2 195 3 TT_C1290 dITP/XTP pyrophosphatase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B1YJW5 1.54e-47 157 45 2 193 3 Exig_2151 dITP/XTP pyrophosphatase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q21XZ3 4.21e-47 156 46 3 197 3 Rfer_1630 dITP/XTP pyrophosphatase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A9BTA7 4.44e-47 156 43 2 197 3 Daci_2032 dITP/XTP pyrophosphatase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q8Y7N5 4.59e-47 156 44 2 193 3 lmo1239 dITP/XTP pyrophosphatase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q720J0 6.02e-47 155 44 2 193 3 LMOf2365_1248 dITP/XTP pyrophosphatase Listeria monocytogenes serotype 4b (strain F2365)
Q88V20 4.7e-46 153 43 3 190 3 lp_2267 dITP/XTP pyrophosphatase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P74432 7.44e-46 152 48 5 188 3 slr0402 dITP/XTP pyrophosphatase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q3A2Y7 1.43e-45 152 46 2 189 3 Pcar_2029 dITP/XTP pyrophosphatase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A1VKF6 2.45e-45 151 46 2 197 3 Pnap_0815 dITP/XTP pyrophosphatase Polaromonas naphthalenivorans (strain CJ2)
Q5HQ23 3.08e-45 151 45 5 193 3 SERP0734 dITP/XTP pyrophosphatase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9K8D9 4.98e-45 150 41 2 194 3 BH3067 dITP/XTP pyrophosphatase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8RC29 5.1e-45 150 42 3 194 3 TTE0620 dITP/XTP pyrophosphatase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q6AQD7 6.42e-45 151 45 4 194 3 DP0707 dITP/XTP pyrophosphatase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q8CSY5 1.26e-44 149 45 5 192 3 SE_0844 dITP/XTP pyrophosphatase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8YM52 1.42e-44 149 45 4 192 3 all5088 dITP/XTP pyrophosphatase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B1MLZ4 1.53e-44 149 44 4 200 1 MAB_1485 dITP/XTP pyrophosphatase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q7V4S3 1.63e-44 149 46 4 195 3 PMT_1872 dITP/XTP pyrophosphatase Prochlorococcus marinus (strain MIT 9313)
Q82D15 1.7e-44 149 47 4 199 3 SAV_5172 dITP/XTP pyrophosphatase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B5YHP2 2.92e-44 149 43 4 194 3 THEYE_A1837 dITP/XTP pyrophosphatase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q5FLV7 4.02e-44 148 43 3 199 3 LBA0426 dITP/XTP pyrophosphatase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B8DVS6 1.24e-43 148 39 4 231 3 BLA_0275 dITP/XTP pyrophosphatase Bifidobacterium animalis subsp. lactis (strain AD011)
Q6AEL0 1.61e-43 147 46 4 195 3 Lxx13570 dITP/XTP pyrophosphatase Leifsonia xyli subsp. xyli (strain CTCB07)
Q67SL4 1.91e-43 146 45 5 197 3 STH344 dITP/XTP pyrophosphatase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8F031 2.17e-43 146 40 4 199 3 LA_3666 dITP/XTP pyrophosphatase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72UV8 2.17e-43 146 40 4 199 3 LIC_10549 dITP/XTP pyrophosphatase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q9CG29 3.24e-43 146 41 4 194 3 ynbD dITP/XTP pyrophosphatase Lactococcus lactis subsp. lactis (strain IL1403)
Q74KU4 4.89e-43 146 42 4 196 3 LJ_0483 dITP/XTP pyrophosphatase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q6GHT4 4.99e-43 145 44 5 194 3 SAR1124 dITP/XTP pyrophosphatase Staphylococcus aureus (strain MRSA252)
P99094 7.07e-43 145 45 5 195 1 SA0998 dITP/XTP pyrophosphatase Staphylococcus aureus (strain N315)
P64309 7.07e-43 145 45 5 195 3 SAV1152 dITP/XTP pyrophosphatase Staphylococcus aureus (strain Mu50 / ATCC 700699)
P58995 7.14e-43 145 45 5 195 3 MW1034 dITP/XTP pyrophosphatase Staphylococcus aureus (strain MW2)
Q6GA63 7.14e-43 145 45 5 195 3 SAS1085 dITP/XTP pyrophosphatase Staphylococcus aureus (strain MSSA476)
Q5HGT2 7.14e-43 145 45 5 195 3 SACOL1162 dITP/XTP pyrophosphatase Staphylococcus aureus (strain COL)
B5YEU3 1.11e-42 145 41 3 192 3 DICTH_1222 dITP/XTP pyrophosphatase Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q9S2H9 1.17e-42 144 46 4 200 3 SCO2902 dITP/XTP pyrophosphatase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B0KBM4 1.26e-42 144 40 4 191 3 Teth39_1682 dITP/XTP pyrophosphatase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q7NN81 2.65e-42 144 47 5 193 3 glr0532 dITP/XTP pyrophosphatase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A1WQF4 2.85e-42 144 46 3 197 3 Veis_4156 dITP/XTP pyrophosphatase Verminephrobacter eiseniae (strain EF01-2)
B0K3T5 3.33e-42 143 40 4 191 3 Teth514_0552 dITP/XTP pyrophosphatase Thermoanaerobacter sp. (strain X514)
Q8EPJ6 9.16e-42 142 39 2 195 3 OB2105 dITP/XTP pyrophosphatase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q0RQL6 1.2e-41 142 43 4 203 3 FRAAL1502 dITP/XTP pyrophosphatase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q73X89 1.28e-41 142 44 6 203 3 MAP_2420c dITP/XTP pyrophosphatase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q5Z0V0 1.39e-41 142 45 4 191 3 NFA_10960 dITP/XTP pyrophosphatase Nocardia farcinica (strain IFM 10152)
Q73KE7 1.77e-41 141 42 5 198 3 TDE_2271 dITP/XTP pyrophosphatase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q5WEM4 8.41e-41 140 41 1 193 3 ABC2651 dITP/XTP pyrophosphatase Shouchella clausii (strain KSM-K16)
Q46H95 1.17e-40 139 43 5 194 3 PMN2A_1645 dITP/XTP pyrophosphatase Prochlorococcus marinus (strain NATL2A)
A2C0B3 1.17e-40 139 43 5 194 3 NATL1_03591 dITP/XTP pyrophosphatase Prochlorococcus marinus (strain NATL1A)
Q8DHZ6 1.18e-40 139 45 4 192 3 tll1797 dITP/XTP pyrophosphatase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8NMR5 1.48e-40 139 43 4 202 3 Cgl2500 dITP/XTP pyrophosphatase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q7U9M0 2.02e-40 139 46 5 195 3 SYNW0234 dITP/XTP pyrophosphatase Parasynechococcus marenigrum (strain WH8102)
Q2RN61 2.23e-40 139 41 3 203 3 Rru_A3640 dITP/XTP pyrophosphatase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8DY93 2.28e-40 142 41 3 193 3 SAG1599 dITP/XTP pyrophosphatase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E3V8 2.28e-40 142 41 3 193 3 gbs1648 dITP/XTP pyrophosphatase Streptococcus agalactiae serotype III (strain NEM316)
A4QGQ5 2.62e-40 139 43 4 202 3 cgR_2413 dITP/XTP pyrophosphatase Corynebacterium glutamicum (strain R)
Q8DSQ6 2.68e-40 142 42 3 193 3 SMU_1717c dITP/XTP pyrophosphatase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9ABS4 6e-40 137 43 5 196 3 CC_0146 dITP/XTP pyrophosphatase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A2SJB9 9.51e-40 137 46 2 195 3 Mpe_A2704 dITP/XTP pyrophosphatase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
P52063 1.05e-39 137 41 5 206 3 ML1175 dITP/XTP pyrophosphatase Mycobacterium leprae (strain TN)
Q7UGM3 1.86e-39 137 44 4 195 3 RB5134 dITP/XTP pyrophosphatase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q6A760 3.4e-39 136 42 5 191 3 PPA1673 dITP/XTP pyrophosphatase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q4JX01 3.84e-39 136 41 4 211 3 jk0499 dITP/XTP pyrophosphatase Corynebacterium jeikeium (strain K411)
O66580 3.9e-39 135 41 6 204 3 aq_202 dITP/XTP pyrophosphatase Aquifex aeolicus (strain VF5)
P0DB59 4.94e-39 139 41 3 193 3 SPs1596 dITP/XTP pyrophosphatase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DB58 4.94e-39 139 41 3 193 3 SpyM3_0263 dITP/XTP pyrophosphatase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P9WMR7 5.01e-39 135 50 2 147 1 Rv1341 dITP/XTP pyrophosphatase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMR6 5.01e-39 135 50 2 147 3 MT1382 dITP/XTP pyrophosphatase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64308 5.01e-39 135 50 2 147 3 BQ2027_MB1376 dITP/XTP pyrophosphatase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0LG38 6.48e-39 136 46 4 186 3 Sfum_0691 dITP/XTP pyrophosphatase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B2V8P5 6.58e-39 135 41 6 208 3 SYO3AOP1_0682 dITP/XTP pyrophosphatase Sulfurihydrogenibium sp. (strain YO3AOP1)
C4L4I7 7.34e-39 135 43 3 189 3 EAT1b_2634 dITP/XTP pyrophosphatase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q891I4 8.17e-39 135 37 4 198 3 CTC_02388 dITP/XTP pyrophosphatase Clostridium tetani (strain Massachusetts / E88)
B0SE38 9.43e-39 134 38 5 201 3 LBF_2585 dITP/XTP pyrophosphatase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q8P2D2 1.32e-38 138 41 3 193 3 spyM18_0412 dITP/XTP pyrophosphatase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q9A1B6 3.32e-38 137 41 3 193 3 SPy_0362 dITP/XTP pyrophosphatase Streptococcus pyogenes serotype M1
B3DTK7 4.82e-38 134 38 7 247 3 BLD_1030 dITP/XTP pyrophosphatase Bifidobacterium longum (strain DJO10A)
Q6NFN7 6.27e-38 133 40 3 197 3 DIP1850 dITP/XTP pyrophosphatase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q8FMU9 7.69e-38 132 42 4 202 3 CE2400 dITP/XTP pyrophosphatase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B2KEA9 8.24e-38 132 41 3 198 3 Emin_1305 dITP/XTP pyrophosphatase Elusimicrobium minutum (strain Pei191)
Q5M626 1.03e-37 135 39 3 193 3 stu0256 dITP/XTP pyrophosphatase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1I4 1.12e-37 135 39 3 193 3 str0256 dITP/XTP pyrophosphatase Streptococcus thermophilus (strain CNRZ 1066)
Q5XDP8 1.6e-37 135 40 3 193 3 M6_Spy0330 dITP/XTP pyrophosphatase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q0IDG4 3.95e-37 130 43 5 188 3 sync_0272 dITP/XTP pyrophosphatase Synechococcus sp. (strain CC9311)
Q8G7I1 8.68e-37 131 38 7 247 3 BL0285 dITP/XTP pyrophosphatase Bifidobacterium longum (strain NCC 2705)
P64311 1.25e-36 129 38 3 193 3 spr1695 dITP/XTP pyrophosphatase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P64310 1.25e-36 129 38 3 193 3 SP_1880 dITP/XTP pyrophosphatase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1VGW8 2.14e-35 126 40 5 204 3 cu1465 dITP/XTP pyrophosphatase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q7VDQ7 8.15e-35 124 38 3 194 3 Pro_0311 dITP/XTP pyrophosphatase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
B9L638 2.09e-34 123 37 5 199 3 NAMH_1434 dITP/XTP pyrophosphatase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
B7GN27 2.35e-34 125 36 6 247 3 Blon_0412 dITP/XTP pyrophosphatase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q6G1E6 2.76e-34 124 38 7 209 3 BQ00480 dITP/XTP pyrophosphatase Bartonella quintana (strain Toulouse)
A6Q6L9 4.12e-34 123 40 4 195 3 SUN_0168 dITP/XTP pyrophosphatase Sulfurovum sp. (strain NBC37-1)
Q1IW81 5.64e-34 122 44 4 195 3 Dgeo_2209 dITP/XTP pyrophosphatase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q64MG2 6.32e-34 122 37 5 199 3 BF4588 dITP/XTP pyrophosphatase Bacteroides fragilis (strain YCH46)
Q98DN4 9e-34 122 38 4 208 3 mlr4626 dITP/XTP pyrophosphatase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
C1CXX6 9.8e-34 122 44 6 199 3 Deide_19360 dITP/XTP pyrophosphatase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
A0M0C9 1.84e-33 120 39 5 194 3 GFO_1100 dITP/XTP pyrophosphatase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q6G565 5.6e-33 120 38 4 207 3 BH00540 dITP/XTP pyrophosphatase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q7MUC6 6.01e-33 119 38 4 193 3 PG_1603 dITP/XTP pyrophosphatase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q5LWF7 1.82e-32 119 41 6 198 3 SPO0007 dITP/XTP pyrophosphatase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q92SK4 3.98e-32 118 36 4 209 3 R00374 dITP/XTP pyrophosphatase Rhizobium meliloti (strain 1021)
Q5HT36 4.44e-32 117 39 5 194 3 CJE1566 dITP/XTP pyrophosphatase Campylobacter jejuni (strain RM1221)
A0RMP5 4.53e-32 117 39 6 196 3 CFF8240_0274 dITP/XTP pyrophosphatase Campylobacter fetus subsp. fetus (strain 82-40)
A7H1W5 4.74e-32 117 39 5 194 3 JJD26997_0276 dITP/XTP pyrophosphatase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q83FT2 6.46e-32 117 38 4 194 3 TWT_621 dITP/XTP pyrophosphatase Tropheryma whipplei (strain Twist)
Q83HF7 7.35e-32 117 39 5 194 3 TW639 dITP/XTP pyrophosphatase Tropheryma whipplei (strain TW08/27)
P64306 9.72e-32 117 37 4 208 3 BR0175 dITP/XTP pyrophosphatase Brucella suis biovar 1 (strain 1330)
P64305 9.72e-32 117 37 4 208 3 BMEI1772 dITP/XTP pyrophosphatase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q30UH9 1.72e-31 116 37 3 194 3 Suden_0071 dITP/XTP pyrophosphatase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A6H0L2 3.38e-31 115 35 5 195 3 FP1819 dITP/XTP pyrophosphatase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
A1W0Z2 3.94e-31 115 39 5 194 3 CJJ81176_1377 dITP/XTP pyrophosphatase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PMS6 3.94e-31 115 39 5 194 1 Cj1374c dITP/XTP pyrophosphatase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q5NRL7 4.23e-31 115 39 4 195 3 ZMO0013 dITP/XTP pyrophosphatase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A8FN54 5.93e-31 114 39 5 194 3 C8J_1293 dITP/XTP pyrophosphatase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q8A327 5.99e-31 114 36 5 198 3 BT_3128 dITP/XTP pyrophosphatase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q7V316 1.22e-30 114 40 4 186 3 PMM0279 dITP/XTP pyrophosphatase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q6NCY9 1.68e-30 114 41 6 205 3 RPA0328 dITP/XTP pyrophosphatase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8EVN6 2.53e-30 113 32 3 199 3 MYPE5240 dITP/XTP pyrophosphatase Malacoplasma penetrans (strain HF-2)
A5E8I8 2.73e-30 113 40 5 204 3 BBta_0185 dITP/XTP pyrophosphatase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A6Q5H7 2.78e-30 113 38 5 198 3 NIS_1630 dITP/XTP pyrophosphatase Nitratiruptor sp. (strain SB155-2)
Q6MF40 3.22e-30 112 37 5 199 3 pc0085 dITP/XTP pyrophosphatase Protochlamydia amoebophila (strain UWE25)
A7HFW2 4.08e-30 113 36 7 232 3 Anae109_3424 dITP/XTP pyrophosphatase Anaeromyxobacter sp. (strain Fw109-5)
A5FH89 4.41e-30 112 36 2 192 3 Fjoh_2403 dITP/XTP pyrophosphatase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
A7ZBP3 5.17e-30 112 38 7 212 3 Ccon26_02910 dITP/XTP pyrophosphatase Campylobacter concisus (strain 13826)
A7HZE0 1.61e-29 111 35 6 205 3 CHAB381_0009 dITP/XTP pyrophosphatase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A8ESC9 2.76e-29 110 37 5 201 3 Abu_0586 dITP/XTP pyrophosphatase Aliarcobacter butzleri (strain RM4018)
Q2IEX2 4.33e-29 110 36 5 224 3 Adeh_3360 dITP/XTP pyrophosphatase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q8UIG9 7e-29 110 37 5 206 3 Atu0326 dITP/XTP pyrophosphatase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q89WK5 7.32e-29 109 39 3 203 3 bll0673 dITP/XTP pyrophosphatase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A6LGA4 8.04e-29 109 33 4 195 3 BDI_3010 dITP/XTP pyrophosphatase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B6IVK5 2.08e-28 108 42 5 191 3 RC1_2961 dITP/XTP pyrophosphatase Rhodospirillum centenum (strain ATCC 51521 / SW)
B3DV19 2.38e-28 108 36 5 190 3 Minf_1117 dITP/XTP pyrophosphatase Methylacidiphilum infernorum (isolate V4)
Q8TV07 4.07e-28 107 39 7 199 3 MK1594 dITP/XTP pyrophosphatase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
B1ZXD5 4.84e-28 107 38 4 201 3 Oter_3653 dITP/XTP pyrophosphatase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Q8KFJ6 7.82e-28 107 38 7 209 3 CT0330 dITP/XTP pyrophosphatase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q7MR19 1.16e-26 103 36 4 201 3 WS1795 dITP/XTP pyrophosphatase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q9RXX6 3.01e-26 102 44 8 183 3 DR_0179 dITP/XTP pyrophosphatase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
C1F8I0 4.36e-26 102 37 6 202 3 ACP_0104 dITP/XTP pyrophosphatase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
Q5FRF4 5.53e-26 102 39 5 194 3 GOX1281 dITP/XTP pyrophosphatase Gluconobacter oxydans (strain 621H)
Q821F9 8.98e-26 101 35 4 197 3 CCA_00982 dITP/XTP pyrophosphatase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
B2S334 1.21e-25 102 37 7 204 3 TPASS_0438 dITP/XTP pyrophosphatase Treponema pallidum subsp. pallidum (strain SS14)
O83452 1.21e-25 102 37 7 204 3 TP_0438 dITP/XTP pyrophosphatase Treponema pallidum (strain Nichols)
Q6MJR8 2.14e-25 100 36 6 197 3 Bd2701 dITP/XTP pyrophosphatase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q5JEX8 1.19e-24 98 36 6 195 3 TK2111 dITP/XTP pyrophosphatase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q5L4Q6 1.58e-24 98 34 5 199 3 CAB952 dITP/XTP pyrophosphatase Chlamydia abortus (strain DSM 27085 / S26/3)
A9NGK2 2.83e-24 97 36 3 190 3 ACL_0869 dITP/XTP pyrophosphatase Acholeplasma laidlawii (strain PG-8A)
Q9Z7D1 4.82e-24 97 34 5 199 3 CPn_0775 dITP/XTP pyrophosphatase Chlamydia pneumoniae
Q256I5 3.99e-23 94 32 4 197 3 CF0031 dITP/XTP pyrophosphatase Chlamydia felis (strain Fe/C-56)
A5IKR2 8.71e-23 93 35 9 197 3 Tpet_0766 dITP/XTP pyrophosphatase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9WY06 8.71e-23 93 35 9 197 1 TM_0159 dITP/XTP pyrophosphatase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q6MT00 1.69e-22 93 32 5 201 3 MSC_0616 dITP/XTP pyrophosphatase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q8U446 2.52e-22 92 32 6 192 3 PF0249 dITP/XTP pyrophosphatase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
B0BA59 2.53e-22 92 35 5 193 3 CTLon_0863 dITP/XTP pyrophosphatase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B8I0 2.53e-22 92 35 5 193 3 CTL0869 dITP/XTP pyrophosphatase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
O84611 6.78e-22 91 35 5 193 3 CT_606 dITP/XTP pyrophosphatase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KL90 6.78e-22 91 35 5 193 3 CTA_0658 dITP/XTP pyrophosphatase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
O59580 6.79e-22 91 33 8 201 1 PH1917 dITP/XTP pyrophosphatase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
B5RL72 1.13e-21 90 31 7 203 3 BDU_248 dITP/XTP pyrophosphatase Borrelia duttonii (strain Ly)
Q8PZ91 3.02e-21 89 35 7 186 3 MM_0603 dITP/XTP pyrophosphatase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8TJS1 4.82e-21 89 35 6 185 3 MA_3706 dITP/XTP pyrophosphatase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
B5RR63 6.08e-21 89 30 7 203 3 BRE_247 dITP/XTP pyrophosphatase Borrelia recurrentis (strain A1)
Q9PJD4 1.38e-20 88 35 5 193 3 TC_0895 dITP/XTP pyrophosphatase Chlamydia muridarum (strain MoPn / Nigg)
B4U8R9 3.86e-20 87 33 8 206 3 HY04AAS1_0843 dITP/XTP pyrophosphatase Hydrogenobaculum sp. (strain Y04AAS1)
Q57679 6.83e-20 85 34 6 193 1 MJ0226 dITP/XTP pyrophosphatase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A8A8W1 8.83e-20 85 32 6 199 3 Igni_0179 dITP/XTP pyrophosphatase Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
O28046 9.14e-20 85 31 5 193 1 AF_2237 dITP/XTP pyrophosphatase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A2BJY7 2.31e-19 84 36 8 197 3 Hbut_0432 dITP/XTP pyrophosphatase Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
Q662B8 5.67e-19 84 30 8 205 3 BG0249 dITP/XTP pyrophosphatase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q4DBX5 7.63e-19 83 33 6 189 3 Tc00.1047053504103.6 Inosine triphosphate pyrophosphatase 1 Trypanosoma cruzi (strain CL Brener)
Q5KPF3 1.73e-18 82 34 8 196 3 CNA03000 Inosine triphosphate pyrophosphatase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
Q0SNR4 2.11e-18 82 28 9 212 3 BAPKO_0256 dITP/XTP pyrophosphatase Borreliella afzelii (strain PKo)
Q4DRX4 2.35e-18 82 33 6 190 3 Tc00.1047053508307.184 Inosine triphosphate pyrophosphatase 2 Trypanosoma cruzi (strain CL Brener)
F4P9L8 3.03e-18 81 29 6 195 3 BATDEDRAFT_13412 Inosine triphosphate pyrophosphatase Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211)
E3KAB5 1.05e-17 80 32 7 197 3 PGTG_06893 Inosine triphosphate pyrophosphatase Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL)
B7J1H5 1.05e-17 80 28 8 197 3 BbuZS7_0252 dITP/XTP pyrophosphatase Borreliella burgdorferi (strain ZS7)
O51263 1.05e-17 80 28 8 197 3 BB_0247 dITP/XTP pyrophosphatase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q4WTN9 1.16e-17 80 32 7 198 3 AFUA_5G05560 Inosine triphosphate pyrophosphatase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q2TX99 3.39e-17 79 32 7 194 3 AO090010000228 Inosine triphosphate pyrophosphatase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A8NZ80 6.47e-17 78 33 6 196 3 CC1G_08181 Inosine triphosphate pyrophosphatase Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003)
D9PYS9 7.24e-17 77 28 5 190 3 MTBMA_c00120 dITP/XTP pyrophosphatase Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q8ZVB5 1.34e-16 77 34 9 202 3 PAE2365 dITP/XTP pyrophosphatase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
C8V9B7 3.42e-16 75 32 7 193 3 AN8861 Inosine triphosphate pyrophosphatase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q6CDL9 9.69e-16 75 32 5 187 3 HAM1 Inosine triphosphate pyrophosphatase Yarrowia lipolytica (strain CLIB 122 / E 150)
Q9VMW7 1.96e-15 74 29 5 193 2 CG8891 Inosine triphosphate pyrophosphatase Drosophila melanogaster
B2B5Q3 2.28e-15 73 32 7 194 3 Pa_2_5430 Inosine triphosphate pyrophosphatase Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383)
Q9HLA4 2.67e-15 73 29 8 195 3 Ta0325 dITP/XTP pyrophosphatase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
C7YTE3 3.07e-15 73 32 7 189 3 NECHADRAFT_105230 Inosine triphosphate pyrophosphatase Fusarium vanettenii (strain ATCC MYA-4622 / CBS 123669 / FGSC 9596 / NRRL 45880 / 77-13-4)
Q7VF43 4.14e-15 74 31 10 234 3 HH_1835 dITP/XTP pyrophosphatase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q6L1H9 2.88e-14 70 28 4 192 3 PTO0588 dITP/XTP pyrophosphatase Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
A7RWC9 5.65e-14 70 28 6 196 3 v1g163483 Inosine triphosphate pyrophosphatase Nematostella vectensis
B1L6T7 6.02e-14 70 31 7 193 3 Kcr_1420 dITP/XTP pyrophosphatase Korarchaeum cryptofilum (strain OPF8)
Q97ZZ0 8.15e-14 70 30 7 197 3 SSO0432 dITP/XTP pyrophosphatase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
F1NLH9 1.53e-13 69 27 4 190 3 ITPA Inosine triphosphate pyrophosphatase Gallus gallus
E0VVF6 1.86e-13 68 29 9 197 3 Phum_PHUM462900 Inosine triphosphate pyrophosphatase Pediculus humanus subsp. corporis
D5GCI8 2.03e-13 68 28 8 200 3 GSTUM_00005907001 Inosine triphosphate pyrophosphatase Tuber melanosporum (strain Mel28)
Q2NLA8 2.16e-13 68 29 5 197 2 itpa Inosine triphosphate pyrophosphatase Xenopus laevis
Q54LQ6 4.23e-13 68 27 5 197 3 itpa Inosine triphosphate pyrophosphatase Dictyostelium discoideum
A8XZP2 1.34e-12 66 29 8 195 3 hap-1 Inosine triphosphate pyrophosphatase Caenorhabditis briggsae
Q6CV82 1.94e-12 66 28 8 199 3 HAM1 Inosine triphosphate pyrophosphatase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
B8BH95 2.63e-12 66 29 7 194 3 OsI_33887 Inosine triphosphate pyrophosphatase Oryza sativa subsp. indica
Q9GYG4 2.82e-12 65 25 6 195 2 hap-1 Inosine triphosphate pyrophosphatase Caenorhabditis elegans
Q7XDP2 2.98e-12 65 30 7 193 2 Os10g0457500 Inosine triphosphate pyrophosphatase Oryza sativa subsp. japonica
C5WZH0 3.48e-12 65 29 7 194 2 Sb01g020160 Inosine triphosphate pyrophosphatase Sorghum bicolor
B6TNW8 4.27e-12 65 31 8 196 2 None Inosine triphosphate pyrophosphatase Zea mays
Q9KDQ1 6.08e-12 65 36 4 125 3 BH1160 Non-canonical purine NTP pyrophosphatase homolog Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8L968 7.36e-12 65 28 6 196 2 At4g13720 Inosine triphosphate pyrophosphatase Arabidopsis thaliana
C0NE84 7.68e-12 64 30 6 193 3 HCBG_02177 Inosine triphosphate pyrophosphatase Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432)
Q4Q0V1 9.22e-12 65 29 9 218 3 LMJF_36_4630 Inosine triphosphate pyrophosphatase Leishmania major
Q4PD06 9.54e-12 64 31 5 191 3 UMAG_02007 Inosine triphosphate pyrophosphatase Ustilago maydis (strain 521 / FGSC 9021)
Q9D892 1.05e-11 64 27 4 193 1 Itpa Inosine triphosphate pyrophosphatase Mus musculus
A5WVX0 1.17e-11 64 27 5 191 2 itpa Inosine triphosphate pyrophosphatase Danio rerio
F6Y089 1.3e-11 63 26 5 194 3 None Inosine triphosphate pyrophosphatase Ciona intestinalis
F6HS55 1.32e-11 64 28 6 192 2 VIT_05s0051g00580 Inosine triphosphate pyrophosphatase Vitis vinifera
D3ZW55 1.96e-11 63 28 6 194 3 Itpa Inosine triphosphate pyrophosphatase Rattus norvegicus
E3QBC5 2.18e-11 63 30 9 196 3 GLRG_03307 Inosine triphosphate pyrophosphatase Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212)
D0MY11 2.27e-11 63 28 5 191 3 PITG_03601 Inosine triphosphate pyrophosphatase Phytophthora infestans (strain T30-4)
Q752Z9 2.53e-11 63 30 7 197 3 HAM1 Inosine triphosphate pyrophosphatase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q0UFP3 3.47e-11 62 30 9 196 3 SNOG_09421 Inosine triphosphate pyrophosphatase Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
Q1K4R6 6.5e-11 62 31 8 195 3 B20D17.150 Inosine triphosphate pyrophosphatase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q9BY32 7.54e-11 62 30 9 194 1 ITPA Inosine triphosphate pyrophosphatase Homo sapiens
Q7Q4F5 8.26e-11 61 28 5 193 3 AGAP008374 Inosine triphosphate pyrophosphatase Anopheles gambiae
B0XL39 1.22e-10 61 28 6 194 3 CPIJ019949 Inosine triphosphate pyrophosphatase Culex quinquefasciatus
Q2GW61 1.29e-10 61 31 9 188 3 CHGG_07793 Inosine triphosphate pyrophosphatase Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
C1FI13 1.29e-10 61 28 5 191 3 MICPUN_61716 Inosine triphosphate pyrophosphatase Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709)
A3LVK6 1.33e-10 61 26 7 204 3 HAM1 Inosine triphosphate pyrophosphatase Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q6BIT7 1.96e-10 60 26 6 199 3 HAM1 Inosine triphosphate pyrophosphatase Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q2KIC5 2.07e-10 60 29 8 197 2 ITPA Inosine triphosphate pyrophosphatase Bos taurus
Q16YB3 2.45e-10 60 28 6 195 3 AAEL008605 Inosine triphosphate pyrophosphatase Aedes aegypti
A8BKZ6 3.53e-10 60 26 5 183 3 GL50803_7511 Inosine triphosphate pyrophosphatase Giardia intestinalis (strain ATCC 50803 / WB clone C6)
A4R1J6 9.32e-10 58 30 9 191 3 MGG_06911 Inosine triphosphate pyrophosphatase Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
A9VE54 1.59e-08 55 26 5 190 3 13033 Inosine triphosphate pyrophosphatase Monosiga brevicollis
P47119 4.56e-08 54 26 6 201 1 HAM1 Inosine triphosphate pyrophosphatase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9UU89 4.6e-08 54 23 6 202 3 SPCC830.10 Inosine triphosphate pyrophosphatase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
C4YRQ5 1.36e-07 53 25 6 205 3 HAM1 Inosine triphosphate pyrophosphatase Candida albicans (strain WO-1)
Q59N80 1.36e-07 53 25 6 205 3 HAM1 Inosine triphosphate pyrophosphatase Candida albicans (strain SC5314 / ATCC MYA-2876)
Q8IBP3 1.49e-05 47 26 7 201 1 MAL7P1.110 Inosine triphosphate pyrophosphatase Plasmodium falciparum (isolate 3D7)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_15030
Feature type CDS
Gene rdgB
Product RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
Location 17303 - 17899 (strand: -1)
Length 597 (nucleotides) / 198 (amino acids)

Contig

Accession contig_20
Length 84833 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1997
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01725 Ham1 family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0127 Nucleotide transport and metabolism (F) F Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01519 XTP/dITP diphosphohydrolase [EC:3.6.1.66] Purine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Nucleotide metabolism		 -

Protein Sequence

MTRKIVLATGNAGKVREMASLLADAGMDVVAQTELGVGSVEETGLTFVENAIIKARHAAKVTGLPAIADDSGISVDYLGGAPGIYSARYAGTDGNDGANIVKLLAALDGVPAAQRQAHFNCVLVYMRHENDPTPIICHGRWAGVIAEQAQGEGGFGYDPVFWLPELNKTAAQLRPEEKQAMSHRGKALALLSEALRNG

Flanking regions ( +/- flanking 50bp)

ATCTCTATAACGATATTGTTCAGTGGATATTTATGTAGTCAGGCGCTGATATGACCCGCAAAATTGTTTTAGCTACCGGCAATGCCGGAAAAGTCCGCGAAATGGCCTCACTGCTGGCGGATGCCGGTATGGATGTGGTGGCGCAAACGGAACTGGGAGTCGGCTCCGTTGAGGAAACCGGCCTGACCTTTGTTGAAAATGCCATTATCAAAGCGCGTCACGCAGCAAAAGTAACCGGTTTACCGGCTATTGCGGATGACTCCGGGATTTCCGTCGATTACCTCGGCGGTGCACCGGGTATCTACTCCGCCCGCTATGCCGGAACTGACGGCAACGACGGCGCCAATATCGTAAAACTGCTGGCCGCTCTTGACGGCGTACCGGCGGCGCAGCGTCAGGCGCACTTCAACTGTGTGCTGGTGTATATGCGTCACGAAAATGACCCGACACCAATCATCTGTCACGGCCGCTGGGCCGGTGTGATTGCAGAGCAGGCGCAGGGCGAAGGCGGTTTCGGTTATGATCCTGTCTTCTGGCTGCCTGAACTGAATAAAACTGCCGCGCAGCTGCGTCCGGAAGAGAAACAGGCTATGTCTCACCGCGGCAAAGCGCTGGCACTACTGTCGGAAGCCCTGCGTAATGGGTAAGCTTCCCCCGCTCAGTCTGTATATTCATATTCCGTGGTGTGTTCAGAAGT