Homologs in group_295

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09760 FBDBKF_09760 27.2 Morganella morganii S1 ybgC tol-pal system-associated acyl-CoA thioesterase
EHELCC_04560 EHELCC_04560 27.2 Morganella morganii S2 ybgC tol-pal system-associated acyl-CoA thioesterase
NLDBIP_04560 NLDBIP_04560 27.2 Morganella morganii S4 ybgC tol-pal system-associated acyl-CoA thioesterase
LHKJJB_14070 LHKJJB_14070 27.2 Morganella morganii S3 ybgC tol-pal system-associated acyl-CoA thioesterase
HKOGLL_12465 HKOGLL_12465 27.2 Morganella morganii S5 ybgC tol-pal system-associated acyl-CoA thioesterase
F4V73_RS00580 F4V73_RS00580 26.3 Morganella psychrotolerans ybgC tol-pal system-associated acyl-CoA thioesterase
PMI_RS02850 PMI_RS02850 25.2 Proteus mirabilis HI4320 ybgC tol-pal system-associated acyl-CoA thioesterase

Distribution of the homologs in the orthogroup group_295

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_295

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q55116 1.04e-10 59 27 1 124 3 sll0410 Putative esterase sll0410 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q45061 5.77e-09 54 31 0 77 3 yneP Putative acyl-CoA thioesterase YneP Bacillus subtilis (strain 168)
O67466 4.92e-06 46 30 0 73 1 aq_1494 Putative esterase aq_1494 Aquifex aeolicus (strain VF5)
P56653 2.77e-05 44 31 3 80 1 None 4-hydroxybenzoyl-CoA thioesterase Pseudomonas sp. (strain CBS-3)
P44679 2.88e-05 44 26 3 108 1 ybgC Acyl-CoA thioesterase YbgC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11980
Feature type CDS
Gene -
Product thioesterase family protein
Location 550355 - 550777 (strand: 1)
Length 423 (nucleotides) / 140 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_295
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF13279 Thioesterase-like superfamily

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0824 Lipid transport and metabolism (I) I Acyl-CoA thioesterase FadM

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07107 acyl-CoA thioester hydrolase [EC:3.1.2.-] - -

Protein Sequence

MLSDPRFTIDVDVFIPFHDCDPMGIVWHGNYLRYFEVAREQLLNQFDYGYRQMLDSGYVWPVVDVKVKYRRSARFEQIVTVRAVIAEYENRLKINYIISDKKTGEKLTTGYTIQVAVEKHTNELQFVSPDILFARMGIEK

Flanking regions ( +/- flanking 50bp)

TCCTTTCTGGCAGTTACCTGCCGATTCTGTCTCACCGGAGGAAAACCGCCATGTTGTCTGATCCGCGTTTTACTATCGATGTGGATGTTTTTATCCCCTTTCATGACTGTGATCCGATGGGGATTGTCTGGCACGGTAACTATCTGCGTTACTTTGAAGTCGCGCGGGAGCAACTGCTTAATCAGTTTGACTACGGCTACCGGCAAATGCTGGATTCCGGTTATGTCTGGCCTGTCGTGGATGTAAAAGTGAAATACCGCCGGTCAGCGCGTTTCGAGCAAATCGTGACGGTTCGTGCCGTAATCGCCGAATATGAAAACAGATTAAAGATTAATTATATTATCAGCGATAAAAAAACGGGTGAAAAACTGACAACCGGTTACACCATACAGGTCGCGGTTGAGAAGCATACCAATGAGCTGCAATTTGTCAGCCCGGATATTTTATTTGCCCGGATGGGGATCGAAAAGTGAAATACATTGTGATAGTACTGCTGTTTATTTCCGGTCTGGCGCAGGCGCTG