Homologs in group_325

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09760 FBDBKF_09760 100.0 Morganella morganii S1 ybgC tol-pal system-associated acyl-CoA thioesterase
NLDBIP_04560 NLDBIP_04560 100.0 Morganella morganii S4 ybgC tol-pal system-associated acyl-CoA thioesterase
LHKJJB_14070 LHKJJB_14070 100.0 Morganella morganii S3 ybgC tol-pal system-associated acyl-CoA thioesterase
HKOGLL_12465 HKOGLL_12465 100.0 Morganella morganii S5 ybgC tol-pal system-associated acyl-CoA thioesterase
F4V73_RS00580 F4V73_RS00580 93.1 Morganella psychrotolerans ybgC tol-pal system-associated acyl-CoA thioesterase
F4V73_RS11980 F4V73_RS11980 27.2 Morganella psychrotolerans - thioesterase family protein
PMI_RS02850 PMI_RS02850 66.7 Proteus mirabilis HI4320 ybgC tol-pal system-associated acyl-CoA thioesterase

Distribution of the homologs in the orthogroup group_325

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_325

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A8Z6 1.86e-58 180 63 0 130 3 ybgC Acyl-CoA thioester hydrolase YbgC Shigella flexneri
P0A8Z3 1.86e-58 180 63 0 130 1 ybgC Acyl-CoA thioester hydrolase YbgC Escherichia coli (strain K12)
P0A8Z4 1.86e-58 180 63 0 130 3 ybgC Acyl-CoA thioester hydrolase YbgC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A8Z5 1.86e-58 180 63 0 130 3 ybgC Acyl-CoA thioester hydrolase YbgC Escherichia coli O157:H7
P44679 2.32e-46 149 58 2 128 1 ybgC Acyl-CoA thioesterase YbgC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9ZLX8 4.64e-20 82 37 4 125 3 ybgC Acyl-CoA thioesterase YbgC Helicobacter pylori (strain J99 / ATCC 700824)
P94842 4.95e-20 82 37 4 125 1 ybgC Acyl-CoA thioesterase YbgC Helicobacter pylori (strain ATCC 700392 / 26695)
O67466 9.6e-12 60 31 0 95 1 aq_1494 Putative esterase aq_1494 Aquifex aeolicus (strain VF5)
Q55116 3.34e-08 52 31 0 88 3 sll0410 Putative esterase sll0410 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q45061 4.13e-08 51 26 1 121 3 yneP Putative acyl-CoA thioesterase YneP Bacillus subtilis (strain 168)
P77712 2.31e-07 49 27 2 113 1 fadM Long-chain acyl-CoA thioesterase FadM Escherichia coli (strain K12)
Q55777 0.000151 42 26 2 123 1 slr0204 1,4-dihydroxy-2-naphthoyl-CoA hydrolase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_04560
Feature type CDS
Gene ybgC
Product tol-pal system-associated acyl-CoA thioesterase
Location 239659 - 240051 (strand: -1)
Length 393 (nucleotides) / 130 (amino acids)

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_325
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF03061 Thioesterase superfamily

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0824 Lipid transport and metabolism (I) I Acyl-CoA thioesterase FadM

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07107 acyl-CoA thioester hydrolase [EC:3.1.2.-] - -

Protein Sequence

MFSWPIRVYYEDTDAGGVVYHGQYLAFFERARTEMLRERGFHQQRLLEEQLGFVVRKLTIDYHHPARLDDLLEVRSEITDIRRASLTFTQTLMHKNGTLLCRAEVLVACVNISLMKPVALPESIVAEFKQ

Flanking regions ( +/- flanking 50bp)

TATAGTTTGCAAAGCATGTTGTCTGATAAAGGTAAGTTGCGGGATATTCAATGTTCAGTTGGCCAATACGGGTTTATTACGAAGATACCGATGCTGGTGGTGTGGTATACCACGGGCAGTATCTTGCATTTTTCGAGCGCGCCAGAACCGAAATGTTACGGGAACGGGGCTTTCATCAGCAGCGTCTGCTGGAAGAGCAGCTCGGCTTTGTGGTCCGCAAATTAACTATCGATTACCACCATCCGGCAAGGTTAGACGATCTGTTAGAGGTACGCAGTGAGATCACCGACATCCGTCGTGCGTCTCTGACATTTACGCAGACACTTATGCATAAAAACGGAACTCTTTTATGTCGCGCAGAGGTACTGGTCGCCTGCGTGAATATTTCTTTAATGAAGCCGGTAGCGCTTCCTGAGTCTATTGTCGCGGAGTTTAAGCAGTGACTGACATGAATATCTGGGATTTATTCCTGAAAGCAAGTTACCTCGTGCAA