Homologs in group_711

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03085 FBDBKF_03085 87.7 Morganella morganii S1 mtgA monofunctional biosynthetic peptidoglycan transglycosylase
EHELCC_07450 EHELCC_07450 87.7 Morganella morganii S2 mtgA monofunctional biosynthetic peptidoglycan transglycosylase
NLDBIP_07775 NLDBIP_07775 87.7 Morganella morganii S4 mtgA monofunctional biosynthetic peptidoglycan transglycosylase
LHKJJB_07310 LHKJJB_07310 87.7 Morganella morganii S3 mtgA monofunctional biosynthetic peptidoglycan transglycosylase
HKOGLL_03620 HKOGLL_03620 87.7 Morganella morganii S5 mtgA monofunctional biosynthetic peptidoglycan transglycosylase
PMI_RS18310 PMI_RS18310 65.2 Proteus mirabilis HI4320 mtgA monofunctional biosynthetic peptidoglycan transglycosylase

Distribution of the homologs in the orthogroup group_711

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_711

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N087 2.05e-107 312 65 0 227 3 mtgA Biosynthetic peptidoglycan transglycosylase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DIR2 2.79e-100 294 61 0 229 3 mtgA Biosynthetic peptidoglycan transglycosylase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q3V7N8 2.77e-99 291 60 0 229 3 mtgA Biosynthetic peptidoglycan transglycosylase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8AQ99 2.61e-95 281 62 0 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q31W84 8.87e-95 280 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Shigella boydii serotype 4 (strain Sb227)
B7NDJ2 9.16e-95 280 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7UJU8 1.91e-94 279 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7LHS1 5.38e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain 55989 / EAEC)
Q1R6C6 6.34e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain UTI89 / UPEC)
Q8FD68 6.34e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCQ1 6.34e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGA9 6.34e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O1:K1 / APEC
B7MBX7 6.34e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O45:K1 (strain S88 / ExPEC)
B6I1T1 6.63e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain SE11)
P46022 6.63e-94 278 58 0 230 1 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain K12)
A8A523 6.63e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O9:H4 (strain HS)
B1XHI3 6.63e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain K12 / DH10B)
C4ZSU7 6.63e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0S6 6.63e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O8 (strain IAI1)
A7ZSA7 6.63e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O139:H28 (strain E24377A / ETEC)
B1LGH4 8.25e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain SMS-3-5 / SECEC)
B7NKS5 8.25e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A9MNZ9 8.43e-94 278 59 0 228 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q32BC5 8.71e-94 278 58 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Shigella dysenteriae serotype 1 (strain Sd197)
A1JR77 1.12e-93 277 63 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1IQR5 2.69e-93 276 57 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7N364 3.16e-93 276 57 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O81 (strain ED1a)
A4THK0 3.72e-93 276 63 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis (strain Pestoides F)
Q1CE18 3.72e-93 276 63 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1R0 3.72e-93 276 63 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZB72 3.72e-93 276 63 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis
Q1C1G0 3.72e-93 276 63 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis bv. Antiqua (strain Antiqua)
Q3V7N9 3.85e-93 276 63 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K3Y6 3.85e-93 276 63 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FDY6 5.7e-93 275 63 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JL77 5.83e-93 275 63 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A9N776 2.01e-92 274 60 0 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TWH8 2.85e-92 274 60 0 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella schwarzengrund (strain CVM19633)
Q8Z3G0 4.81e-92 273 60 0 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella typhi
C0PZM1 8.68e-92 273 60 0 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella paratyphi C (strain RKS4594)
B5RES4 8.68e-92 273 60 0 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0J9 8.68e-92 273 60 0 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella enteritidis PT4 (strain P125109)
Q57JE2 8.68e-92 273 60 0 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella choleraesuis (strain SC-B67)
Q8ZLR7 9.89e-92 272 60 0 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4T739 9.89e-92 272 60 0 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella newport (strain SL254)
B4TJQ1 9.89e-92 272 60 0 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella heidelberg (strain SL476)
Q48465 1.65e-91 272 62 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Klebsiella oxytoca
B5F6X7 1.77e-91 272 60 0 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella agona (strain SL483)
B5BGN2 2.03e-91 271 60 0 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella paratyphi A (strain AKU_12601)
Q3V7K4 2.03e-91 271 60 0 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5YSU1 3.15e-91 271 57 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X9I1 3.15e-91 271 57 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O157:H7
B5FIQ6 1.75e-90 269 60 0 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella dublin (strain CT_02021853)
Q3YX33 7.41e-90 268 57 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Shigella sonnei (strain Ss046)
A7MJD8 7.64e-86 257 58 1 231 3 mtgA Biosynthetic peptidoglycan transglycosylase Cronobacter sakazakii (strain ATCC BAA-894)
Q65S86 5.18e-74 228 53 1 206 3 mtgA Biosynthetic peptidoglycan transglycosylase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P44890 1e-72 224 53 0 202 3 mtgA Biosynthetic peptidoglycan transglycosylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CNV0 6.43e-69 214 54 1 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Pasteurella multocida (strain Pm70)
A5UDP3 1.82e-68 213 50 0 203 3 mtgA Biosynthetic peptidoglycan transglycosylase Haemophilus influenzae (strain PittEE)
Q1QYT5 6.28e-68 212 55 2 197 3 mtgA Biosynthetic peptidoglycan transglycosylase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9PCR3 1.51e-66 208 48 1 210 3 mtgA Biosynthetic peptidoglycan transglycosylase Xylella fastidiosa (strain 9a5c)
B0U2V1 3.81e-65 205 45 2 226 3 mtgA Biosynthetic peptidoglycan transglycosylase Xylella fastidiosa (strain M12)
Q87CI7 7.56e-65 204 45 2 226 3 mtgA Biosynthetic peptidoglycan transglycosylase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5D0 7.56e-65 204 45 2 226 3 mtgA Biosynthetic peptidoglycan transglycosylase Xylella fastidiosa (strain M23)
A4VRK8 7.36e-64 201 51 2 203 3 mtgA Biosynthetic peptidoglycan transglycosylase Stutzerimonas stutzeri (strain A1501)
Q3V7R3 9.21e-64 201 49 4 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q8EB02 3.1e-63 199 46 2 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A6VRW7 3.14e-63 199 54 2 196 3 mtgA Biosynthetic peptidoglycan transglycosylase Marinomonas sp. (strain MWYL1)
Q9I6B7 2.59e-62 197 46 2 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4K4C2 2.97e-62 197 48 2 229 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A5WAE0 4.68e-62 197 45 2 233 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B1J2G5 8.98e-62 196 46 2 228 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas putida (strain W619)
B0KN61 9.69e-62 196 45 2 233 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas putida (strain GB-1)
Q88CS3 9.8e-62 196 45 2 233 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88AF9 1.99e-61 195 47 2 229 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C3K3M0 6.24e-61 194 52 3 204 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas fluorescens (strain SBW25)
Q8P6V1 7.41e-61 194 45 1 210 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RQA5 7.41e-61 194 45 1 210 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas campestris pv. campestris (strain B100)
Q4UXB0 7.41e-61 194 45 1 210 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas campestris pv. campestris (strain 8004)
Q3K584 1.75e-60 193 47 4 227 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas fluorescens (strain Pf0-1)
Q1IGD6 2.47e-60 192 47 3 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas entomophila (strain L48)
A4Y001 3.46e-60 192 50 2 203 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas mendocina (strain ymp)
Q4ZM52 4.44e-60 192 50 2 205 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas syringae pv. syringae (strain B728a)
Q48CL6 9.3e-60 191 49 2 205 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8A8H2 1.1e-59 191 42 2 231 3 mtgA Biosynthetic peptidoglycan transglycosylase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8PI51 4.9e-59 189 43 1 210 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas axonopodis pv. citri (strain 306)
Q3BQP8 5.25e-58 187 43 1 210 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q5H1V9 5.64e-58 187 41 1 226 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P4R3 5.64e-58 187 41 1 226 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A0KK53 3.82e-57 184 50 3 206 3 mtgA Biosynthetic peptidoglycan transglycosylase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q87FR1 5.01e-55 178 42 2 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q3V815 1.44e-54 178 41 2 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Bacteroides fragilis (strain YCH46)
Q3V7G2 1.44e-54 178 41 2 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q28VR9 1.85e-54 177 44 4 212 3 mtgA Biosynthetic peptidoglycan transglycosylase Jannaschia sp. (strain CCS1)
Q07X68 2.99e-54 176 46 3 202 3 mtgA Biosynthetic peptidoglycan transglycosylase Shewanella frigidimarina (strain NCIMB 400)
Q12Q34 2.21e-51 169 45 3 202 3 mtgA Biosynthetic peptidoglycan transglycosylase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q2RYG3 2.07e-50 167 46 4 209 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B6IWJ6 2.57e-49 164 50 1 170 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodospirillum centenum (strain ATCC 51521 / SW)
B8GYX9 7.32e-49 163 40 3 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9ABA6 7.32e-49 163 40 3 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q11VI0 5.94e-47 158 42 3 214 3 mtgA Biosynthetic peptidoglycan transglycosylase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A1S3J2 2.99e-46 157 52 1 169 3 mtgA Biosynthetic peptidoglycan transglycosylase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A3M3C7 3.63e-44 150 38 2 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
O24849 4.72e-44 150 39 3 220 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q1QQI5 1.52e-43 149 47 4 179 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q8FYT4 2.96e-43 148 44 3 188 3 mtgA Biosynthetic peptidoglycan transglycosylase Brucella suis biovar 1 (strain 1330)
Q89VU8 4.27e-43 148 47 2 167 3 mtgA Biosynthetic peptidoglycan transglycosylase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B2HVP6 5.51e-43 147 46 0 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain ACICU)
B0VSQ2 5.63e-43 147 46 0 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain SDF)
B0V9M4 5.81e-43 147 46 0 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain AYE)
B7I8R1 5.81e-43 147 46 0 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain AB0057)
B7GXW9 5.81e-43 147 46 0 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain AB307-0294)
Q13ED9 6.23e-43 147 41 5 209 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodopseudomonas palustris (strain BisB5)
Q8YJ15 7.56e-43 147 43 3 188 3 mtgA Biosynthetic peptidoglycan transglycosylase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q3SVC8 7.66e-43 147 46 4 179 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q3SFZ8 2.01e-42 146 44 0 179 3 mtgA Biosynthetic peptidoglycan transglycosylase Thiobacillus denitrificans (strain ATCC 25259)
Q2KUU2 1.36e-41 144 38 3 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Bordetella avium (strain 197N)
Q8UBX8 1.86e-41 144 48 2 156 3 mtgA Biosynthetic peptidoglycan transglycosylase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q5P6J8 2.58e-41 144 41 0 181 3 mtgA Biosynthetic peptidoglycan transglycosylase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q2J2T4 3.81e-41 143 48 1 153 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodopseudomonas palustris (strain HaA2)
A4G8N2 6.69e-41 142 41 0 188 3 mtgA Biosynthetic peptidoglycan transglycosylase Herminiimonas arsenicoxydans
A6T2A4 7.37e-41 142 42 0 189 3 mtgA Biosynthetic peptidoglycan transglycosylase Janthinobacterium sp. (strain Marseille)
B3QBD2 1.4e-40 142 46 5 179 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodopseudomonas palustris (strain TIE-1)
Q6NCE7 1.4e-40 142 46 5 179 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A1K3B8 4.54e-40 140 45 1 166 3 mtgA Biosynthetic peptidoglycan transglycosylase Azoarcus sp. (strain BH72)
Q1MAC8 1.17e-39 140 39 5 208 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q7NS41 1.25e-39 139 42 0 179 3 mtgA Biosynthetic peptidoglycan transglycosylase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2YBM4 2.81e-39 138 37 0 208 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B3PR74 4.07e-39 138 40 5 207 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium etli (strain CIAT 652)
B5ZU97 6.67e-39 137 39 5 208 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q0VLR6 1.64e-38 137 43 0 168 3 mtgA Biosynthetic peptidoglycan transglycosylase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q11CS6 1.64e-38 137 37 7 229 3 mtgA Biosynthetic peptidoglycan transglycosylase Chelativorans sp. (strain BNC1)
Q7W039 3.53e-38 136 35 2 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3V2 3.53e-38 136 35 2 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WF82 3.53e-38 136 35 2 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q1GYH8 3.61e-38 135 41 0 179 3 mtgA Biosynthetic peptidoglycan transglycosylase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q2K330 4.23e-38 135 40 4 190 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q478U7 6.23e-38 135 43 1 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Dechloromonas aromatica (strain RCB)
C1D8R6 7.29e-38 134 39 0 179 3 mtgA Biosynthetic peptidoglycan transglycosylase Laribacter hongkongensis (strain HLHK9)
Q92L23 5.82e-37 132 45 1 152 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium meliloti (strain 1021)
Q82U73 8.06e-37 132 49 0 139 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q13U46 3.82e-36 130 42 0 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Paraburkholderia xenovorans (strain LB400)
B2SYS3 4.54e-36 130 41 0 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q51005 2.55e-35 128 42 2 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria gonorrhoeae
Q5F6F6 2.55e-35 128 42 2 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q98FG8 5.4e-35 127 41 7 207 3 mtgA Biosynthetic peptidoglycan transglycosylase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2SZD0 8.61e-35 127 42 0 165 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B2JH09 3.56e-34 125 40 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B4RJ59 3.86e-34 125 42 2 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria gonorrhoeae (strain NCCP11945)
Q3V7M0 1.01e-33 125 41 0 165 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia mallei (strain ATCC 23344)
Q63QP9 1.56e-33 124 41 0 165 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia pseudomallei (strain K96243)
A4JBE7 1.16e-32 122 41 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0AIQ0 4.77e-32 120 45 0 139 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
P0A0Z3 5.07e-32 119 42 2 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q1LIV1 5.52e-32 119 46 1 139 3 mtgA Biosynthetic peptidoglycan transglycosylase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P0A0Z4 5.77e-32 119 42 2 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9AI31 1.05e-31 119 40 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia multivorans (strain ATCC 17616 / 249)
Q0BIE9 1.05e-31 119 40 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1BZB0 1.13e-31 119 40 0 165 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia orbicola (strain AU 1054)
A0K4E0 1.13e-31 119 40 0 165 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia cenocepacia (strain HI2424)
P69345 1.16e-31 117 41 2 162 3 mtgA Biosynthetic peptidoglycan transglycosylase (Fragment) Neisseria meningitidis
B1YSX5 1.21e-31 119 40 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia ambifaria (strain MC40-6)
B1JVD0 1.22e-31 119 40 0 165 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia orbicola (strain MC0-3)
A9M2N3 1.34e-31 119 41 2 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria meningitidis serogroup C (strain 053442)
Q39JR9 1.61e-31 119 40 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8XVQ4 2.68e-31 118 46 0 128 3 mtgA Biosynthetic peptidoglycan transglycosylase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A1KVS7 3.07e-31 117 41 2 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q46XB8 7.7e-30 114 42 2 157 3 mtgA Biosynthetic peptidoglycan transglycosylase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P70997 1e-28 117 34 2 208 2 pbpG Penicillin-binding protein 2D Bacillus subtilis (strain 168)
Q1RKC5 1.14e-24 105 37 2 161 3 mrcA Penicillin-binding protein 1A Rickettsia bellii (strain RML369-C)
P38050 1.91e-24 104 38 0 133 2 pbpF Penicillin-binding protein 1F Bacillus subtilis (strain 168)
Q9ZCE9 2.25e-23 101 38 2 152 3 mrcA Penicillin-binding protein 1A Rickettsia prowazekii (strain Madrid E)
Q68VU2 2.45e-23 101 38 2 152 3 mrcA Penicillin-binding protein 1A Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q92G78 5.98e-23 100 37 2 152 3 mrcA Penicillin-binding protein 1A Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P40750 7.27e-23 100 34 0 162 1 pbpD Penicillin-binding protein 4 Bacillus subtilis (strain 168)
Q4UK08 7.52e-23 100 38 2 152 3 mrcA Penicillin-binding protein 1A Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q07806 9.35e-22 97 35 0 153 1 mrcA Penicillin-binding protein 1A Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A5IU40 1.23e-21 93 36 3 149 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain JH9)
A6U2X8 1.23e-21 93 36 3 149 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain JH1)
Q7A0I6 2.22e-21 92 36 3 149 1 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain MW2)
A8YY46 2.22e-21 92 36 3 149 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G860 2.22e-21 92 36 3 149 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain MSSA476)
Q6GFI3 2.22e-21 92 36 3 149 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain MRSA252)
Q7A4S6 2.22e-21 92 36 3 149 1 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain N315)
Q99T05 2.22e-21 92 36 3 149 1 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QI56 2.22e-21 92 36 3 149 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain Newman)
Q5HEQ0 2.22e-21 92 36 3 149 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain COL)
Q2YU13 2.22e-21 92 36 3 149 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q93Q23 2.22e-21 92 36 3 149 1 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFM1 2.22e-21 92 36 3 149 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain USA300)
A7X3Z2 2.22e-21 92 36 3 149 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
O87626 2.83e-21 95 38 0 152 3 mrcA Penicillin-binding protein 1A Neisseria flavescens
Q4L7I0 3.18e-21 92 29 4 221 3 mgt Monofunctional glycosyltransferase Staphylococcus haemolyticus (strain JCSC1435)
P71707 2.19e-20 92 31 5 228 1 ponA1 Penicillin-binding protein 1A Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8CNQ3 2.51e-20 90 34 3 149 3 mgt Monofunctional glycosyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HN60 2.51e-20 90 34 3 149 3 mgt Monofunctional glycosyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P39793 3.87e-20 92 33 2 196 1 ponA Penicillin-binding protein 1A/1B Bacillus subtilis (strain 168)
P02918 4.61e-20 92 41 0 133 1 mrcA Penicillin-binding protein 1A Escherichia coli (strain K12)
Q0SRL7 5.12e-20 91 29 5 260 3 pbpA Penicillin-binding protein 1A Clostridium perfringens (strain SM101 / Type A)
Q8DNB6 1.05e-19 90 33 2 181 1 pbp2a Penicillin-binding protein 2a Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZMF9 1.05e-19 90 33 2 181 1 pbp2a Penicillin-binding protein 2a Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q07259 1.24e-19 87 35 3 156 3 H16_A0665 Putative transglycosylase H16_A0665 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
O87579 1.66e-19 90 35 0 152 3 mrcA Penicillin-binding protein 1A Neisseria lactamica
P31776 2.14e-19 90 39 0 129 1 mrcA Penicillin-binding protein 1A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O05131 2.47e-19 89 35 0 152 1 mrcA Penicillin-binding protein 1A Neisseria gonorrhoeae
Q5FAC7 2.47e-19 89 35 0 152 3 mrcA Penicillin-binding protein 1A Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9KNU5 2.59e-19 89 36 0 149 3 mrcA Penicillin-binding protein 1A Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q49YR9 2.83e-19 87 32 3 178 3 mgt Monofunctional glycosyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P0A0Z6 2.9e-19 89 35 0 152 3 mrcA Penicillin-binding protein 1A Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0Z5 2.9e-19 89 35 0 152 3 mrcA Penicillin-binding protein 1A Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
O86088 1.24e-18 87 34 0 152 3 mrcA Penicillin-binding protein 1A Neisseria cinerea
Q8XJ01 1.48e-18 87 28 5 251 3 pbpA Penicillin-binding protein 1A Clostridium perfringens (strain 13 / Type A)
A0R7G2 1.57e-18 87 30 2 224 3 ponA1 Penicillin-binding protein 1A Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q0TNZ8 7.22e-18 85 33 4 182 3 pbpA Penicillin-binding protein 1A Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A7GHV1 1.43e-17 84 33 4 175 3 pbpA Penicillin-binding protein 1A Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5I6G4 1.43e-17 84 33 4 175 3 pbpA Penicillin-binding protein 1A Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FY32 1.43e-17 84 33 4 175 3 pbpA Penicillin-binding protein 1A Clostridium botulinum (strain ATCC 19397 / Type A)
P45345 4.57e-17 83 38 1 130 3 mrcB Penicillin-binding protein 1B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q97GR5 1.33e-16 82 36 5 165 3 pbpA Penicillin-binding protein 1A Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q891X1 2.39e-16 81 38 3 133 3 pbpA Penicillin-binding protein 1A Clostridium tetani (strain Massachusetts / E88)
O66874 4.36e-16 80 41 0 112 1 mrcA Penicillin-binding protein 1A Aquifex aeolicus (strain VF5)
P02919 7.53e-14 73 36 1 126 1 mrcB Penicillin-binding protein 1B Escherichia coli (strain K12)
Q00573 8.83e-14 73 30 2 161 3 ponA Penicillin-binding protein 1A (Fragment) Streptococcus oralis
Q87AW7 1.69e-13 72 32 3 156 3 mrcA Penicillin-binding protein 1A Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PGD4 1.88e-13 72 32 3 156 3 mrcA Penicillin-binding protein 1A Xylella fastidiosa (strain 9a5c)
Q04707 4.81e-13 71 31 2 156 1 ponA Penicillin-binding protein 1A Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q9KUC0 4.69e-12 68 35 1 130 3 mrcB Penicillin-binding protein 1B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8DR59 5.98e-12 68 30 2 156 1 pbpA Penicillin-binding protein 1A Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P76577 7.07e-12 68 33 2 162 1 pbpC Penicillin-binding protein 1C Escherichia coli (strain K12)
Q89AR2 1.01e-11 67 36 1 122 3 mrcB Penicillin-binding protein 1B Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57296 1.29e-11 67 34 1 126 3 mrcB Penicillin-binding protein 1B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A0PZT1 2.96e-11 66 31 6 176 3 pbpA Penicillin-binding protein 1A Clostridium novyi (strain NT)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11835
Feature type CDS
Gene mtgA
Product monofunctional biosynthetic peptidoglycan transglycosylase
Location 522673 - 523383 (strand: 1)
Length 711 (nucleotides) / 236 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_711
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00912 Transglycosylase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0744 Cell wall/membrane/envelope biogenesis (M) M Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03814 monofunctional glycosyltransferase [EC:2.4.99.28] Peptidoglycan biosynthesis
Metabolic pathways		 -

Protein Sequence

MGRILRFLRKIVIFVMLLWVTMIILFAFLPVPYSMVMLERQVSAWATFNFSYVARSTWAGESAISPYMKLAVIASEDQRFPDHHGFDFDAISDALSQSSKKGHSSRGASTLTQQTVKNLFLWDGRSWARKGLETLLTPGVELIWSKSRILTVYLNIAEFGPGIFGVEAASQHFFRKSAKNLTAAQAALLAAVLPNPHRLRADKPSAYVRGRQQWILHQMQLLGGTGFLEKNNLTDK

Flanking regions ( +/- flanking 50bp)

AATTGGTTAAGAAAGTTCTGCAAATGGCCGGATAATCAGTGAGGGAAATTATGGGGAGGATTTTGCGGTTTCTGCGGAAAATAGTTATTTTTGTTATGTTGTTATGGGTAACAATGATAATTTTGTTCGCATTTCTCCCTGTTCCCTATTCTATGGTGATGCTGGAAAGACAGGTTTCAGCATGGGCAACATTTAATTTTTCTTATGTCGCCCGCAGCACATGGGCAGGCGAAAGTGCCATTTCCCCTTATATGAAGCTGGCAGTGATTGCATCAGAAGATCAACGCTTCCCTGATCATCACGGATTTGATTTTGACGCAATTTCCGATGCGCTCTCACAAAGCAGTAAAAAAGGGCATTCATCCAGAGGCGCGTCCACACTGACACAGCAGACAGTGAAAAATCTATTCTTGTGGGACGGACGTAGTTGGGCGCGTAAGGGGCTGGAAACGTTACTGACGCCGGGTGTGGAACTTATCTGGTCAAAATCCAGGATCCTGACGGTCTATCTCAATATTGCCGAGTTCGGACCGGGGATTTTTGGTGTGGAAGCGGCATCACAGCACTTTTTCCGTAAAAGTGCCAAAAATTTGACTGCGGCGCAGGCAGCTCTGCTGGCCGCAGTATTACCTAATCCGCATCGTCTGCGCGCGGATAAGCCATCTGCTTATGTGCGCGGGCGTCAGCAATGGATTTTACACCAGATGCAACTGCTGGGCGGGACCGGGTTCCTGGAGAAAAATAACCTTACAGATAAGTAACCGGAATACAGTCAATCCCCTTATTATTTCGTATTGTTTAGCCTTAACGA