Homologs in group_782

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_07450 EHELCC_07450 100.0 Morganella morganii S2 mtgA monofunctional biosynthetic peptidoglycan transglycosylase
NLDBIP_07775 NLDBIP_07775 100.0 Morganella morganii S4 mtgA monofunctional biosynthetic peptidoglycan transglycosylase
LHKJJB_07310 LHKJJB_07310 100.0 Morganella morganii S3 mtgA monofunctional biosynthetic peptidoglycan transglycosylase
HKOGLL_03620 HKOGLL_03620 100.0 Morganella morganii S5 mtgA monofunctional biosynthetic peptidoglycan transglycosylase
F4V73_RS11835 F4V73_RS11835 87.7 Morganella psychrotolerans mtgA monofunctional biosynthetic peptidoglycan transglycosylase
PMI_RS18310 PMI_RS18310 65.7 Proteus mirabilis HI4320 mtgA monofunctional biosynthetic peptidoglycan transglycosylase

Distribution of the homologs in the orthogroup group_782

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_782

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N087 1.02e-106 310 63 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3V7N8 4.39e-101 296 60 1 236 3 mtgA Biosynthetic peptidoglycan transglycosylase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DIR2 5.52e-101 296 61 1 236 3 mtgA Biosynthetic peptidoglycan transglycosylase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q31W84 6.72e-96 283 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Shigella boydii serotype 4 (strain Sb227)
A8AQ99 2.19e-95 281 63 0 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MNZ9 5.02e-95 281 61 0 228 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7LHS1 5.67e-95 281 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain 55989 / EAEC)
A1JR77 7.77e-95 280 65 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B6I1T1 8.58e-95 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain SE11)
P46022 8.58e-95 280 60 0 230 1 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain K12)
A8A523 8.58e-95 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O9:H4 (strain HS)
B1XHI3 8.58e-95 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain K12 / DH10B)
C4ZSU7 8.58e-95 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0S6 8.58e-95 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O8 (strain IAI1)
A7ZSA7 8.58e-95 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1R6C6 9.16e-95 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain UTI89 / UPEC)
Q8FD68 9.16e-95 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCQ1 9.16e-95 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGA9 9.16e-95 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O1:K1 / APEC
B7MBX7 9.16e-95 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O45:K1 (strain S88 / ExPEC)
B1LGH4 1.17e-94 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain SMS-3-5 / SECEC)
B7NKS5 1.17e-94 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q32BC5 1.19e-94 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Shigella dysenteriae serotype 1 (strain Sd197)
B7NDJ2 1.42e-94 280 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q3V7N9 1.5e-94 280 65 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K3Y6 1.5e-94 280 65 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A4THK0 1.82e-94 279 65 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis (strain Pestoides F)
Q1CE18 1.82e-94 279 65 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1R0 1.82e-94 279 65 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZB72 1.82e-94 279 65 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis
Q1C1G0 1.82e-94 279 65 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FDY6 2.03e-94 279 65 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JL77 2.34e-94 279 64 0 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
B7UJU8 3.52e-94 278 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1IQR5 4.14e-94 278 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7N364 4.47e-94 278 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O81 (strain ED1a)
B5YSU1 5.96e-93 275 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X9I1 5.96e-93 275 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O157:H7
A9N776 3.7e-92 273 63 0 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TWH8 5.31e-92 273 63 0 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella schwarzengrund (strain CVM19633)
Q8Z3G0 1.14e-91 272 63 0 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella typhi
Q8ZLR7 2.17e-91 271 63 0 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4T739 2.17e-91 271 63 0 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella newport (strain SL254)
B4TJQ1 4.1e-91 271 62 0 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella heidelberg (strain SL476)
C0PZM1 4.37e-91 271 62 0 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella paratyphi C (strain RKS4594)
B5RES4 4.37e-91 271 62 0 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0J9 4.37e-91 271 62 0 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella enteritidis PT4 (strain P125109)
Q57JE2 4.37e-91 271 62 0 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella choleraesuis (strain SC-B67)
B5BGN2 5.1e-91 271 62 0 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella paratyphi A (strain AKU_12601)
Q3V7K4 5.1e-91 271 62 0 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5F6X7 1.25e-90 270 62 0 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella agona (strain SL483)
Q3YX33 1.45e-90 270 60 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Shigella sonnei (strain Ss046)
Q48465 9.12e-90 267 63 0 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Klebsiella oxytoca
B5FIQ6 9.53e-90 267 62 0 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella dublin (strain CT_02021853)
A7MJD8 4.77e-87 260 60 1 231 3 mtgA Biosynthetic peptidoglycan transglycosylase Cronobacter sakazakii (strain ATCC BAA-894)
Q65S86 1.07e-74 229 53 2 213 3 mtgA Biosynthetic peptidoglycan transglycosylase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P44890 7.65e-71 219 52 0 202 3 mtgA Biosynthetic peptidoglycan transglycosylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q1QYT5 2.63e-68 213 55 2 197 3 mtgA Biosynthetic peptidoglycan transglycosylase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8P6V1 1.33e-67 211 49 1 210 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RQA5 1.33e-67 211 49 1 210 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas campestris pv. campestris (strain B100)
Q4UXB0 1.33e-67 211 49 1 210 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas campestris pv. campestris (strain 8004)
Q8EB02 1.49e-67 211 48 3 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0U2V1 7.19e-67 209 46 2 226 3 mtgA Biosynthetic peptidoglycan transglycosylase Xylella fastidiosa (strain M12)
A5UDP3 1.15e-66 209 49 0 203 3 mtgA Biosynthetic peptidoglycan transglycosylase Haemophilus influenzae (strain PittEE)
Q87CI7 1.41e-66 208 48 1 212 3 mtgA Biosynthetic peptidoglycan transglycosylase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5D0 1.41e-66 208 48 1 212 3 mtgA Biosynthetic peptidoglycan transglycosylase Xylella fastidiosa (strain M23)
Q9PCR3 1.77e-66 208 49 1 210 3 mtgA Biosynthetic peptidoglycan transglycosylase Xylella fastidiosa (strain 9a5c)
Q9CNV0 3.39e-66 207 52 1 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Pasteurella multocida (strain Pm70)
Q5H1V9 4.86e-66 207 46 1 226 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P4R3 4.86e-66 207 46 1 226 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PI51 5.53e-66 207 48 1 210 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas axonopodis pv. citri (strain 306)
Q3BQP8 1.48e-65 206 47 1 210 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q4K4C2 2.07e-64 203 49 2 229 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9I6B7 4.11e-64 202 46 2 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A4VRK8 3.16e-63 200 51 2 203 3 mtgA Biosynthetic peptidoglycan transglycosylase Stutzerimonas stutzeri (strain A1501)
Q3K584 5.28e-63 199 48 4 227 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas fluorescens (strain Pf0-1)
C3K3M0 3.46e-62 197 50 3 206 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas fluorescens (strain SBW25)
A5WAE0 3.98e-62 197 46 2 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B1J2G5 4.02e-62 197 46 2 228 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas putida (strain W619)
Q1IGD6 4.99e-62 197 48 3 210 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas entomophila (strain L48)
Q88CS3 7.72e-62 196 46 2 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KN61 9.28e-62 196 46 2 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas putida (strain GB-1)
Q8A8H2 1.28e-61 196 45 2 222 3 mtgA Biosynthetic peptidoglycan transglycosylase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A6VRW7 3.41e-61 194 51 2 196 3 mtgA Biosynthetic peptidoglycan transglycosylase Marinomonas sp. (strain MWYL1)
A0KK53 5.18e-61 194 51 4 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4Y001 7.55e-61 194 51 2 203 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas mendocina (strain ymp)
Q88AF9 4.03e-60 192 46 3 230 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q28VR9 5.61e-60 191 46 4 221 3 mtgA Biosynthetic peptidoglycan transglycosylase Jannaschia sp. (strain CCS1)
Q3V7R3 8.27e-60 191 46 5 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q4ZM52 4.35e-59 189 49 3 206 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas syringae pv. syringae (strain B728a)
Q48CL6 5.52e-58 186 48 2 205 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q87FR1 3.66e-57 184 43 2 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q3V815 6.69e-56 181 43 2 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Bacteroides fragilis (strain YCH46)
Q3V7G2 6.69e-56 181 43 2 218 3 mtgA Biosynthetic peptidoglycan transglycosylase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q07X68 2.46e-54 177 46 3 202 3 mtgA Biosynthetic peptidoglycan transglycosylase Shewanella frigidimarina (strain NCIMB 400)
Q2RYG3 1.18e-52 172 47 3 207 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q12Q34 2.85e-52 171 46 2 196 3 mtgA Biosynthetic peptidoglycan transglycosylase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B6IWJ6 7.68e-52 171 54 1 165 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodospirillum centenum (strain ATCC 51521 / SW)
B8GYX9 1.69e-51 169 42 3 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9ABA6 1.69e-51 169 42 3 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A3M3C7 1.65e-48 162 40 2 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HVP6 3.57e-47 158 48 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain ACICU)
B0V9M4 3.69e-47 158 48 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain AYE)
B7I8R1 3.69e-47 158 48 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain AB0057)
B7GXW9 3.69e-47 158 48 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain AB307-0294)
B0VSQ2 3.73e-47 158 48 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain SDF)
O24849 6.49e-47 157 40 3 220 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A1S3J2 7.39e-46 155 51 1 170 3 mtgA Biosynthetic peptidoglycan transglycosylase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q11VI0 8.01e-46 155 40 3 227 3 mtgA Biosynthetic peptidoglycan transglycosylase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q2KUU2 1.51e-45 155 41 3 225 3 mtgA Biosynthetic peptidoglycan transglycosylase Bordetella avium (strain 197N)
A4G8N2 1.62e-45 154 43 0 188 3 mtgA Biosynthetic peptidoglycan transglycosylase Herminiimonas arsenicoxydans
A6T2A4 4.91e-45 153 44 0 188 3 mtgA Biosynthetic peptidoglycan transglycosylase Janthinobacterium sp. (strain Marseille)
Q13ED9 6.42e-45 153 44 4 196 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodopseudomonas palustris (strain BisB5)
Q3SFZ8 3.84e-44 151 43 1 195 3 mtgA Biosynthetic peptidoglycan transglycosylase Thiobacillus denitrificans (strain ATCC 25259)
Q1QQI5 1.16e-43 149 47 3 180 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q89VU8 1.2e-43 149 47 2 170 3 mtgA Biosynthetic peptidoglycan transglycosylase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5P6J8 2.59e-43 149 45 0 181 3 mtgA Biosynthetic peptidoglycan transglycosylase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q11CS6 6.92e-43 148 39 7 229 3 mtgA Biosynthetic peptidoglycan transglycosylase Chelativorans sp. (strain BNC1)
Q2J2T4 7.07e-43 147 50 1 154 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodopseudomonas palustris (strain HaA2)
Q2YBM4 1.3e-42 147 39 0 208 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A1K3B8 3.35e-42 146 48 2 168 3 mtgA Biosynthetic peptidoglycan transglycosylase Azoarcus sp. (strain BH72)
Q1MAC8 6.64e-42 145 42 5 209 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B3QBD2 7.26e-42 145 46 4 180 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodopseudomonas palustris (strain TIE-1)
Q6NCE7 7.26e-42 145 46 4 180 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8FYT4 7.36e-42 145 43 3 188 3 mtgA Biosynthetic peptidoglycan transglycosylase Brucella suis biovar 1 (strain 1330)
Q8YJ15 1.53e-41 144 42 4 198 3 mtgA Biosynthetic peptidoglycan transglycosylase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
B3PR74 1.72e-41 144 42 5 208 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium etli (strain CIAT 652)
Q3SVC8 1.78e-41 144 45 4 180 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q7W039 3.14e-41 144 37 2 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3V2 3.14e-41 144 37 2 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WF82 3.14e-41 144 37 2 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B5ZU97 6.34e-41 142 42 5 209 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q8UBX8 1.43e-40 141 45 1 167 3 mtgA Biosynthetic peptidoglycan transglycosylase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q13U46 3.07e-40 141 44 0 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Paraburkholderia xenovorans (strain LB400)
Q92L23 3.14e-40 141 42 5 205 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium meliloti (strain 1021)
B2SYS3 3.93e-40 140 43 0 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q98FG8 8.9e-40 140 42 6 213 3 mtgA Biosynthetic peptidoglycan transglycosylase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2K330 1.16e-39 139 43 4 191 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q0VLR6 4.14e-39 138 44 0 165 3 mtgA Biosynthetic peptidoglycan transglycosylase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
C1D8R6 5.53e-39 137 37 0 206 3 mtgA Biosynthetic peptidoglycan transglycosylase Laribacter hongkongensis (strain HLHK9)
Q478U7 6.75e-39 137 44 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Dechloromonas aromatica (strain RCB)
Q82U73 1.14e-38 137 43 0 179 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q7NS41 4.54e-38 135 38 0 202 3 mtgA Biosynthetic peptidoglycan transglycosylase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2SZD0 4.85e-38 136 44 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q1GYH8 1.07e-37 134 43 0 179 3 mtgA Biosynthetic peptidoglycan transglycosylase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B2JH09 7.3e-37 132 41 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q3V7M0 1.2e-36 132 43 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia mallei (strain ATCC 23344)
Q63QP9 1.5e-36 132 43 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia pseudomallei (strain K96243)
B4RJ59 6.47e-36 130 43 2 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria gonorrhoeae (strain NCCP11945)
Q1BZB0 4.28e-35 128 42 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia orbicola (strain AU 1054)
A0K4E0 4.28e-35 128 42 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia cenocepacia (strain HI2424)
B1JVD0 4.52e-35 128 42 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia orbicola (strain MC0-3)
Q0BIE9 6.85e-35 127 42 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A1KVS7 6.89e-35 127 43 2 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q51005 6.97e-35 127 42 2 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria gonorrhoeae
Q5F6F6 6.97e-35 127 42 2 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B1YSX5 7.62e-35 127 42 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia ambifaria (strain MC40-6)
Q39JR9 8.39e-35 127 42 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0AIQ0 1.1e-34 127 37 0 201 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A9AI31 1.14e-34 127 41 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia multivorans (strain ATCC 17616 / 249)
P0A0Z3 1.55e-34 126 43 2 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0A0Z4 1.82e-34 126 43 2 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M2N3 2.21e-34 125 42 2 163 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria meningitidis serogroup C (strain 053442)
P69345 2.93e-34 123 43 2 162 3 mtgA Biosynthetic peptidoglycan transglycosylase (Fragment) Neisseria meningitidis
A4JBE7 1.24e-33 124 41 0 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1LIV1 7.84e-33 122 45 1 139 3 mtgA Biosynthetic peptidoglycan transglycosylase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q46XB8 2.07e-31 119 42 2 157 3 mtgA Biosynthetic peptidoglycan transglycosylase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8XVQ4 3.94e-31 117 41 1 158 3 mtgA Biosynthetic peptidoglycan transglycosylase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P70997 1.72e-28 116 34 1 208 2 pbpG Penicillin-binding protein 2D Bacillus subtilis (strain 168)
Q1RKC5 3.66e-25 106 37 2 161 3 mrcA Penicillin-binding protein 1A Rickettsia bellii (strain RML369-C)
P38050 5.34e-25 106 35 2 162 2 pbpF Penicillin-binding protein 1F Bacillus subtilis (strain 168)
P40750 1.73e-23 101 34 0 165 1 pbpD Penicillin-binding protein 4 Bacillus subtilis (strain 168)
Q68VU2 2.39e-23 101 39 2 152 3 mrcA Penicillin-binding protein 1A Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UK08 5.13e-23 100 37 2 161 3 mrcA Penicillin-binding protein 1A Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9ZCE9 5.27e-23 100 38 2 152 3 mrcA Penicillin-binding protein 1A Rickettsia prowazekii (strain Madrid E)
Q92G78 7.89e-23 100 38 2 152 3 mrcA Penicillin-binding protein 1A Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q07806 3.85e-22 97 37 0 153 1 mrcA Penicillin-binding protein 1A Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A5IU40 4.86e-22 94 33 3 172 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain JH9)
A6U2X8 4.86e-22 94 33 3 172 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain JH1)
Q7A0I6 9.32e-22 94 33 3 172 1 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain MW2)
A8YY46 9.32e-22 94 33 3 172 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G860 9.32e-22 94 33 3 172 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain MSSA476)
Q6GFI3 9.32e-22 94 33 3 172 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain MRSA252)
Q7A4S6 9.32e-22 94 33 3 172 1 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain N315)
Q99T05 9.32e-22 94 33 3 172 1 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QI56 9.32e-22 94 33 3 172 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain Newman)
Q5HEQ0 9.32e-22 94 33 3 172 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain COL)
Q2YU13 9.32e-22 94 33 3 172 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q93Q23 9.32e-22 94 33 3 172 1 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFM1 9.32e-22 94 33 3 172 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain USA300)
A7X3Z2 9.32e-22 94 33 3 172 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q07259 3.3e-21 91 35 4 171 3 H16_A0665 Putative transglycosylase H16_A0665 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
O66874 1.11e-20 93 35 3 188 1 mrcA Penicillin-binding protein 1A Aquifex aeolicus (strain VF5)
Q4L7I0 1.2e-20 90 32 3 173 3 mgt Monofunctional glycosyltransferase Staphylococcus haemolyticus (strain JCSC1435)
O87626 1.75e-20 93 36 0 164 3 mrcA Penicillin-binding protein 1A Neisseria flavescens
P02918 3.27e-20 92 40 0 139 1 mrcA Penicillin-binding protein 1A Escherichia coli (strain K12)
Q8DNB6 3.95e-20 92 33 2 168 1 pbp2a Penicillin-binding protein 2a Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZMF9 3.95e-20 92 33 2 168 1 pbp2a Penicillin-binding protein 2a Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q0SRL7 4.93e-20 92 28 5 256 3 pbpA Penicillin-binding protein 1A Clostridium perfringens (strain SM101 / Type A)
P0A0Z6 1.45e-19 90 36 0 152 3 mrcA Penicillin-binding protein 1A Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0Z5 1.45e-19 90 36 0 152 3 mrcA Penicillin-binding protein 1A Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
O05131 1.53e-19 90 36 0 152 1 mrcA Penicillin-binding protein 1A Neisseria gonorrhoeae
Q5FAC7 1.53e-19 90 36 0 152 3 mrcA Penicillin-binding protein 1A Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P31776 1.64e-19 90 36 0 149 1 mrcA Penicillin-binding protein 1A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P39793 1.69e-19 90 36 1 168 1 ponA Penicillin-binding protein 1A/1B Bacillus subtilis (strain 168)
Q9KNU5 1.7e-19 90 30 6 233 3 mrcA Penicillin-binding protein 1A Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O87579 1.79e-19 90 36 0 152 3 mrcA Penicillin-binding protein 1A Neisseria lactamica
P71707 5.32e-19 89 30 4 220 1 ponA1 Penicillin-binding protein 1A Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0R7G2 6.49e-19 88 33 1 169 3 ponA1 Penicillin-binding protein 1A Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8XJ01 7.82e-19 88 27 4 246 3 pbpA Penicillin-binding protein 1A Clostridium perfringens (strain 13 / Type A)
O86088 9.53e-19 88 35 0 152 3 mrcA Penicillin-binding protein 1A Neisseria cinerea
Q8CNQ3 1.17e-18 85 33 3 148 3 mgt Monofunctional glycosyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HN60 1.17e-18 85 33 3 148 3 mgt Monofunctional glycosyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q0TNZ8 3.13e-18 86 34 3 172 3 pbpA Penicillin-binding protein 1A Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q49YR9 2.28e-17 82 32 3 162 3 mgt Monofunctional glycosyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q891X1 5.65e-17 82 31 2 174 3 pbpA Penicillin-binding protein 1A Clostridium tetani (strain Massachusetts / E88)
A7GHV1 5.66e-17 82 35 4 165 3 pbpA Penicillin-binding protein 1A Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5I6G4 5.66e-17 82 35 4 165 3 pbpA Penicillin-binding protein 1A Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FY32 5.66e-17 82 35 4 165 3 pbpA Penicillin-binding protein 1A Clostridium botulinum (strain ATCC 19397 / Type A)
P45345 5.03e-16 80 36 1 130 3 mrcB Penicillin-binding protein 1B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q97GR5 6.43e-16 79 33 5 165 3 pbpA Penicillin-binding protein 1A Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q87AW7 6.78e-15 77 33 3 160 3 mrcA Penicillin-binding protein 1A Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PGD4 7.04e-15 76 33 3 160 3 mrcA Penicillin-binding protein 1A Xylella fastidiosa (strain 9a5c)
P02919 3.05e-14 75 35 1 126 1 mrcB Penicillin-binding protein 1B Escherichia coli (strain K12)
Q00573 2.79e-13 72 30 1 156 3 ponA Penicillin-binding protein 1A (Fragment) Streptococcus oralis
Q9KUC0 2.92e-13 72 35 1 130 3 mrcB Penicillin-binding protein 1B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P57296 4.01e-12 68 33 2 133 3 mrcB Penicillin-binding protein 1B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P76577 7.01e-12 68 32 2 164 1 pbpC Penicillin-binding protein 1C Escherichia coli (strain K12)
Q04707 3.98e-11 65 29 2 156 1 ponA Penicillin-binding protein 1A Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q89AR2 6.58e-11 65 35 1 122 3 mrcB Penicillin-binding protein 1B Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8DR59 1.79e-10 63 28 2 156 1 pbpA Penicillin-binding protein 1A Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0PZT1 1.59e-09 61 30 6 174 3 pbpA Penicillin-binding protein 1A Clostridium novyi (strain NT)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_03085
Feature type CDS
Gene mtgA
Product monofunctional biosynthetic peptidoglycan transglycosylase
Location 15765 - 16475 (strand: -1)
Length 711 (nucleotides) / 236 (amino acids)
In genomic island -

Contig

Accession contig_3
Length 210665 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_782
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00912 Transglycosylase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0744 Cell wall/membrane/envelope biogenesis (M) M Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03814 peptidoglycan glycosyltransferase [EC:2.4.99.28] Peptidoglycan biosynthesis
Metabolic pathways
-

Protein Sequence

MGRILRFLRKIVVFVMLLWVTMIILFAFLPVPYSMVMLERQLSAWSTFNFSYVAHSTWAGEDAISPQMKLAVIASEDQNFPHHHGFDFGAISDALSKSGKKGRAARGASTLSQQTVKNLFLWDGRSWVRKGLETLLTPGIELVWSKSRILTVYLNIAEFGPGIFGAEAAAQHFFGKSAKNLTAAEAALLAAVLPNPHRLHADKPSAYLRQRQQWILHQMQLLGGTTFLKKNNLADN

Flanking regions ( +/- flanking 50bp)

AACTCGTGAAGAAAGTGCTCGGAATGGCCTGATAAAGAATGAGGAAAATGATGGGGAGGATATTGCGGTTTCTGCGAAAAATAGTTGTTTTTGTTATGTTGTTATGGGTAACAATGATAATTTTGTTCGCGTTCCTCCCTGTCCCTTACTCTATGGTGATGCTGGAAAGGCAGCTTTCGGCATGGTCAACATTCAATTTTTCTTATGTCGCTCACAGTACATGGGCGGGTGAAGACGCTATTTCCCCGCAGATGAAGCTGGCGGTGATTGCGTCTGAGGATCAGAATTTCCCGCACCACCACGGTTTTGACTTTGGTGCTATCTCCGACGCACTGTCAAAAAGCGGTAAGAAAGGCCGGGCGGCACGCGGTGCATCCACACTGAGCCAGCAGACGGTCAAGAACCTGTTTCTGTGGGATGGCCGCAGCTGGGTACGAAAAGGGCTGGAAACGCTGCTGACGCCCGGTATTGAGCTGGTCTGGTCAAAGTCACGGATCCTGACGGTGTATCTCAATATCGCGGAGTTCGGGCCGGGAATTTTCGGTGCCGAAGCGGCGGCGCAGCACTTTTTCGGCAAAAGCGCGAAAAATCTGACGGCGGCTGAGGCTGCATTACTGGCTGCCGTGCTGCCGAATCCCCACCGGTTGCATGCGGATAAACCTTCCGCGTATCTCCGCCAGCGTCAGCAATGGATATTGCATCAGATGCAGTTGCTGGGCGGAACAACGTTCCTGAAGAAAAATAATCTGGCTGATAATTAGCCGCAGTATAATGAATTTATCTTACTGATTTGTTTTTTTACAAAAATGAT