Homologs in group_2595

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03165 FBDBKF_03165 79.0 Morganella morganii S1 tauB ABC-type taurine transport system, ATPase component
EHELCC_07370 EHELCC_07370 79.0 Morganella morganii S2 tauB ABC-type taurine transport system, ATPase component
NLDBIP_07695 NLDBIP_07695 79.0 Morganella morganii S4 tauB ABC-type taurine transport system, ATPase component
LHKJJB_07230 LHKJJB_07230 79.0 Morganella morganii S3 tauB ABC-type taurine transport system, ATPase component
HKOGLL_03700 HKOGLL_03700 79.0 Morganella morganii S5 tauB ABC-type taurine transport system, ATPase component

Distribution of the homologs in the orthogroup group_2595

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2595

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q471U2 5.06e-80 244 51 0 235 3 tauB Taurine import ATP-binding protein TauB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0K2U3 6.27e-79 241 50 0 235 3 tauB Taurine import ATP-binding protein TauB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1IGM2 7.23e-79 241 45 0 255 3 tauB Taurine import ATP-binding protein TauB Pseudomonas entomophila (strain L48)
Q8KZR4 7.45e-79 241 46 0 257 3 tauB Taurine import ATP-binding protein TauB Pseudomonas putida
Q87UH7 1.13e-78 241 46 0 257 3 tauB Taurine import ATP-binding protein TauB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88RA1 4.12e-78 239 45 0 257 3 tauB Taurine import ATP-binding protein TauB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q3KJQ7 1.57e-77 238 46 0 257 3 tauB Taurine import ATP-binding protein TauB Pseudomonas fluorescens (strain Pf0-1)
Q48C94 3.72e-77 237 46 0 256 3 tauB Taurine import ATP-binding protein TauB Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q02SA6 1.97e-76 235 47 0 245 3 tauB Taurine import ATP-binding protein TauB Pseudomonas aeruginosa (strain UCBPP-PA14)
Q4KK16 2.5e-76 235 45 0 257 3 tauB Taurine import ATP-binding protein TauB Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9HX79 8.27e-76 233 46 0 245 3 tauB Taurine import ATP-binding protein TauB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q664P8 1.17e-74 230 46 1 243 3 tauB Taurine import ATP-binding protein TauB Yersinia pseudotuberculosis serotype I (strain IP32953)
Q98DW6 3.4e-74 229 44 0 252 3 tauB Taurine import ATP-binding protein TauB Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8X5I6 5.35e-73 226 46 1 243 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O157:H7
Q1CCR9 6.03e-73 226 46 1 243 3 tauB Taurine import ATP-binding protein TauB Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZJD0 6.03e-73 226 46 1 243 3 tauB Taurine import ATP-binding protein TauB Yersinia pestis
Q1C2S1 6.03e-73 226 46 1 243 3 tauB Taurine import ATP-binding protein TauB Yersinia pestis bv. Antiqua (strain Antiqua)
Q2T751 1.23e-72 225 42 1 254 3 tauB Taurine import ATP-binding protein TauB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q146E7 1.57e-72 225 47 0 235 3 tauB1 Taurine import ATP-binding protein TauB 1 Paraburkholderia xenovorans (strain LB400)
Q3JKX3 3.35e-72 224 42 1 254 3 tauB Taurine import ATP-binding protein TauB Burkholderia pseudomallei (strain 1710b)
Q62AW4 3.35e-72 224 42 1 254 3 tauB Taurine import ATP-binding protein TauB Burkholderia mallei (strain ATCC 23344)
Q63JZ3 4.03e-72 224 42 1 254 3 tauB Taurine import ATP-binding protein TauB Burkholderia pseudomallei (strain K96243)
Q1RFH8 4.82e-72 224 46 1 243 3 tauB Taurine import ATP-binding protein TauB Escherichia coli (strain UTI89 / UPEC)
Q0TKS1 4.82e-72 224 46 1 243 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FKF5 2.6e-71 222 45 1 243 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7NU46 3.14e-71 222 45 0 255 3 tauB Taurine import ATP-binding protein TauB Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q3Z542 4.48e-71 221 46 1 243 3 tauB Taurine import ATP-binding protein TauB Shigella sonnei (strain Ss046)
Q47538 4.48e-71 221 46 1 243 2 tauB Taurine import ATP-binding protein TauB Escherichia coli (strain K12)
Q325N3 5.64e-71 221 46 1 243 3 tauB Taurine import ATP-binding protein TauB Shigella boydii serotype 4 (strain Sb227)
Q6W2B1 7.44e-71 221 43 1 258 3 tauB Taurine import ATP-binding protein TauB Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q1BT84 1.69e-70 220 45 2 251 3 tauB Taurine import ATP-binding protein TauB Burkholderia orbicola (strain AU 1054)
Q39CJ6 1.69e-70 220 45 2 251 3 tauB Taurine import ATP-binding protein TauB Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A0KAV6 1.69e-70 220 45 2 251 3 tauB Taurine import ATP-binding protein TauB Burkholderia cenocepacia (strain HI2424)
Q83MA0 3.32e-70 219 45 1 243 3 tauB Taurine import ATP-binding protein TauB Shigella flexneri
Q32IZ6 2.22e-69 217 45 1 243 3 tauB Taurine import ATP-binding protein TauB Shigella dysenteriae serotype 1 (strain Sd197)
Q0T7M2 3.05e-69 216 45 1 243 3 tauB Taurine import ATP-binding protein TauB Shigella flexneri serotype 5b (strain 8401)
Q13IS7 1.81e-68 215 44 0 251 3 tauB3 Taurine import ATP-binding protein TauB 3 Paraburkholderia xenovorans (strain LB400)
Q1M7R4 1.68e-67 212 46 0 225 3 tauB Taurine import ATP-binding protein TauB Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2K164 2.18e-67 212 46 0 225 3 tauB Taurine import ATP-binding protein TauB Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q92UX0 3.66e-66 209 44 1 249 3 tauB Taurine import ATP-binding protein TauB Rhizobium meliloti (strain 1021)
Q13KX9 4.25e-66 209 43 2 249 3 tauB2 Taurine import ATP-binding protein TauB 2 Paraburkholderia xenovorans (strain LB400)
Q6RH47 9.25e-63 201 41 1 249 3 tauB Taurine import ATP-binding protein TauB Paracoccus pantotrophus
Q28K97 1.02e-61 198 44 3 250 3 tauB Taurine import ATP-binding protein TauB Jannaschia sp. (strain CCS1)
Q4FMG5 4.2e-61 196 44 3 248 3 tauB Taurine import ATP-binding protein TauB Pelagibacter ubique (strain HTCC1062)
Q16BJ3 6.67e-60 193 45 1 231 3 tauB Taurine import ATP-binding protein TauB Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q5LVM5 5.39e-59 191 41 3 248 3 tauB Taurine import ATP-binding protein TauB Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q55463 1.77e-55 182 39 5 256 2 cmpD Bicarbonate transport ATP-binding protein CmpD Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5MZ53 2.95e-55 181 40 5 254 3 cmpD Bicarbonate transport ATP-binding protein CmpD Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q55108 2.95e-55 181 40 5 254 1 cmpD Bicarbonate transport ATP-binding protein CmpD Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q57855 4.32e-50 168 41 1 204 3 MJ0412 Uncharacterized ABC transporter ATP-binding protein MJ0412 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P38046 4.62e-49 166 36 3 247 1 nrtD Nitrate import ATP-binding protein NrtD Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P73265 1.14e-46 159 34 3 238 3 nrtD Nitrate import ATP-binding protein NrtD Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P39459 1.71e-45 156 37 3 208 3 nasD Nitrate transport protein NasD Klebsiella oxytoca
Q55462 6.58e-45 162 38 2 222 2 cmpC Bicarbonate transport ATP-binding protein CmpC Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8FUN3 6.3e-44 152 43 1 204 3 BRA1187 Putative ATP-binding protein BRA1187/BS1330_II1178 Brucella suis biovar 1 (strain 1330)
Q2YJB5 6.3e-44 152 43 1 204 3 BAB2_1147 Putative ATP-binding protein BAB2_1147 Brucella abortus (strain 2308)
Q1BG75 1.29e-43 151 40 3 202 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia orbicola (strain AU 1054)
A0KE71 1.29e-43 151 40 3 202 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia cenocepacia (strain HI2424)
Q5MZ54 1.46e-43 159 37 2 216 3 cmpC Bicarbonate transport ATP-binding protein CmpC Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q55107 1.46e-43 159 37 2 216 1 cmpC Bicarbonate transport ATP-binding protein CmpC Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q576E0 4.04e-43 150 42 1 204 3 BruAb2_1123 Putative ATP-binding protein BruAb2_1123 Brucella abortus biovar 1 (strain 9-941)
Q39LW7 3.03e-42 148 40 3 202 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q65M64 1.05e-41 146 37 3 218 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q0SML1 1.38e-40 145 37 2 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
P38045 1.55e-40 150 38 2 207 1 nrtC Nitrate import ATP-binding protein NrtC Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O51587 1.66e-40 145 37 4 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q660M8 2.37e-40 145 37 4 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q81C68 9.16e-40 141 34 2 225 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8ELR4 1.18e-39 144 41 4 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q74K65 1.75e-39 143 41 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8A883 3.62e-39 144 40 4 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
P73450 6.13e-39 146 36 3 216 3 nrtC Nitrate import ATP-binding protein NrtC Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8Y8T6 9.73e-39 141 40 5 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q830W6 1.01e-38 141 40 4 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
P97027 1.26e-38 138 33 4 216 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bacillus subtilis (strain 168)
Q8DZJ0 1.54e-38 141 39 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E554 1.54e-38 141 39 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype III (strain NEM316)
Q3K0Y6 1.54e-38 141 39 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q81P94 1.74e-38 137 35 2 225 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bacillus anthracis
Q63A38 2.64e-38 137 36 1 199 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bacillus cereus (strain ZK / E33L)
Q6HHI7 2.75e-38 137 35 2 225 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q722B1 2.85e-38 140 40 5 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serotype 4b (strain F2365)
Q736E0 3.06e-38 137 36 1 199 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RFA4 3.34e-38 137 37 1 199 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bacillus thuringiensis (strain Al Hakam)
Q03AH0 3.46e-38 140 40 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A0AGP9 3.82e-38 140 40 5 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q14Q07 3.91e-38 139 36 4 251 3 potA Spermidine/putrescine import ATP-binding protein PotA Spiroplasma citri
Q18AM3 4.78e-38 139 42 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridioides difficile (strain 630)
Q042G7 6.36e-38 139 41 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q1GIE5 6.37e-38 139 39 4 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria sp. (strain TM1040)
A3DDF6 7.36e-38 139 40 3 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q5LBT4 9.54e-38 140 41 3 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64SQ6 9.64e-38 140 41 3 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain YCH46)
Q92DL6 1.06e-37 139 40 5 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P44513 1.22e-37 138 36 7 231 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P94360 1.5e-37 138 37 3 222 1 msmX Oligosaccharides import ATP-binding protein MsmX Bacillus subtilis (strain 168)
Q4QP85 2.96e-37 137 36 7 231 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Haemophilus influenzae (strain 86-028NP)
Q24XJ2 3.58e-37 137 41 5 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Desulfitobacterium hafniense (strain Y51)
Q5M397 4.1e-37 137 38 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYN4 4.1e-37 137 38 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
Q03JH1 4.6e-37 137 38 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q9JUX4 1.41e-36 135 39 4 200 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JZW0 2.51e-36 135 39 4 200 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q0SRL2 2.82e-36 134 41 5 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain SM101 / Type A)
Q1WVI7 4.08e-36 134 39 4 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q5WCI1 4.57e-36 131 37 2 199 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Shouchella clausii (strain KSM-K16)
Q8D653 4.59e-36 134 37 6 209 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio vulnificus (strain CMCP6)
Q7CN92 4.64e-36 134 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99ZS8 4.64e-36 134 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M1
A0PY57 4.73e-36 134 40 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium novyi (strain NT)
Q5L222 5.16e-36 134 38 3 198 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q1J6Q6 5.2e-36 134 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGY7 5.2e-36 134 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLT7 5.2e-36 134 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBV6 5.2e-36 134 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q5FA19 5.28e-36 134 37 6 217 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q5FL41 5.33e-36 134 42 5 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q1QE80 5.5e-36 135 40 3 203 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q5XCA4 5.96e-36 134 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8XIZ5 6.07e-36 133 39 3 203 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain 13 / Type A)
Q0TNZ3 6.07e-36 133 39 3 203 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
P0CZ35 6.28e-36 134 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TP4 6.28e-36 134 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M28 (strain MGAS6180)
P0CZ34 6.28e-36 134 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P77481 7.69e-36 133 37 3 209 5 ycjV Putative uncharacterized ABC transporter ATP-binding protein YcjV Escherichia coli (strain K12)
Q8PP41 7.84e-36 130 34 2 222 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Xanthomonas axonopodis pv. citri (strain 306)
Q6F0V4 9.73e-36 133 36 4 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q88ZJ6 9.9e-36 133 38 3 203 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8X8K4 1e-35 133 37 3 209 3 ycjV Uncharacterized ABC transporter ATP-binding protein YcjV Escherichia coli O157:H7
Q03PF2 1.08e-35 133 39 3 203 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q0BUR6 1.18e-35 130 39 5 205 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q8FHR3 1.82e-35 132 37 3 209 3 ycjV Uncharacterized ABC transporter ATP-binding protein YcjV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TI47 1.89e-35 132 37 3 209 3 ycjV Uncharacterized ABC transporter ATP-binding protein YcjV Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0SK28 1.93e-35 129 39 4 201 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Rhodococcus jostii (strain RHA1)
Q8DUF7 1.98e-35 133 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q81GU1 2.61e-35 132 38 3 195 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9I6L0 2.75e-35 131 34 6 238 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4W575 2.98e-35 132 37 6 217 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVH1 2.98e-35 132 37 6 217 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q1RC47 3.34e-35 132 37 3 209 4 ycjV Uncharacterized ABC transporter ATP-binding protein YcjV Escherichia coli (strain UTI89 / UPEC)
Q8XZP8 4.78e-35 132 38 6 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A3CMQ7 4.89e-35 132 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus sanguinis (strain SK36)
Q8CPN0 5.47e-35 131 40 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q48FT0 5.6e-35 129 39 3 191 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q93DX8 5.84e-35 129 36 7 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
O31339 7.06e-35 131 37 4 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q9G4F5 7.38e-35 130 38 5 206 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q88CL2 7.71e-35 130 37 5 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q00752 8.37e-35 131 35 1 210 3 msmK Multiple sugar-binding transport ATP-binding protein MsmK Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5HQ70 8.58e-35 130 40 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O34314 9.22e-35 128 33 0 203 3 ytlC Uncharacterized ABC transporter ATP-binding protein YtlC Bacillus subtilis (strain 168)
Q3M5J9 1.02e-34 128 33 5 240 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q4ZQE3 1.1e-34 128 39 4 196 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas syringae pv. syringae (strain B728a)
Q04G50 1.18e-34 130 38 4 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q38VW6 1.2e-34 130 38 4 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
Q8DPC2 1.22e-34 131 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q42 1.22e-34 131 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JW0 1.22e-34 131 37 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q5ZWE4 1.62e-34 130 38 4 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q02R79 1.7e-34 130 39 2 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas aeruginosa (strain UCBPP-PA14)
Q7W9U5 1.75e-34 130 38 5 206 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q9HY19 1.77e-34 130 39 2 202 3 potA2 Spermidine/putrescine import ATP-binding protein PotA 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7WGW1 1.84e-34 130 38 5 206 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VNG4 1.9e-34 130 36 3 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q5X627 2.09e-34 130 38 4 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q63TW1 2.14e-34 129 35 5 220 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia pseudomallei (strain K96243)
P77795 2.19e-34 129 40 6 222 3 ydcT Uncharacterized ABC transporter ATP-binding protein YdcT Escherichia coli (strain K12)
Q65T42 2.35e-34 129 34 7 238 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q63TY1 2.43e-34 129 36 7 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q62K82 3.06e-34 129 36 7 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q02QT1 3.24e-34 127 36 1 187 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q1IGL4 3.69e-34 127 38 2 187 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas entomophila (strain L48)
Q5WXF0 3.86e-34 129 38 4 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q3MAR5 4.16e-34 129 37 4 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q62K56 4.17e-34 128 35 5 220 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia mallei (strain ATCC 23344)
Q21XJ9 4.4e-34 127 33 3 233 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q2SSS4 4.76e-34 129 36 3 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q3JSR6 4.93e-34 128 35 5 220 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia pseudomallei (strain 1710b)
Q6CYU2 4.97e-34 126 37 4 205 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q1LLP5 5.03e-34 129 36 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8YM92 6.17e-34 129 37 4 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q1MQ44 6.58e-34 129 37 4 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
Q9CGD4 6.78e-34 129 36 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. lactis (strain IL1403)
Q3KBH4 6.99e-34 128 37 6 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain Pf0-1)
Q4L5B3 7.31e-34 128 40 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus haemolyticus (strain JCSC1435)
Q7VZE5 7.42e-34 128 37 5 206 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q6MU19 7.7e-34 128 36 3 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
O32151 7.96e-34 128 33 4 228 3 yurJ Uncharacterized ABC transporter ATP-binding protein YurJ Bacillus subtilis (strain 168)
Q04BG2 8.16e-34 128 39 3 198 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q50966 8.27e-34 128 36 6 217 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae
Q2SVN0 8.42e-34 127 36 4 206 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q02Z10 8.79e-34 129 36 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. cremoris (strain SK11)
Q6NBT1 9.07e-34 128 38 7 210 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q5NN23 9.55e-34 125 37 3 189 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q885N4 9.78e-34 125 38 3 190 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q30V33 1.16e-33 128 35 4 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q97KS6 1.17e-33 127 36 4 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q89UD2 1.25e-33 127 38 5 206 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q82TL6 1.36e-33 127 37 4 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P31134 1.56e-33 127 38 6 214 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
Q82MV1 1.79e-33 125 38 6 191 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9HYG4 1.94e-33 125 36 2 187 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1BWL4 2.34e-33 126 36 4 204 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia orbicola (strain AU 1054)
A0K739 2.34e-33 126 36 4 204 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia cenocepacia (strain HI2424)
Q6F9A8 2.42e-33 127 36 4 206 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q5WBL0 2.99e-33 124 36 2 189 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Shouchella clausii (strain KSM-K16)
Q88AS5 3.03e-33 126 36 6 209 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q664X5 3.27e-33 127 35 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CNR8 3.27e-33 127 35 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZAS8 3.27e-33 127 35 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pestis
Q1CC21 3.27e-33 127 35 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pestis bv. Antiqua (strain Antiqua)
Q1GB17 3.3e-33 126 39 3 198 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q0RKH4 3.69e-33 124 38 4 189 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q9K876 4.08e-33 126 37 6 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q63E84 4.1e-33 125 35 3 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ZK / E33L)
Q73BM0 4.1e-33 125 35 3 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBB0 4.1e-33 125 35 3 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis (strain Al Hakam)
Q9TKX3 4.18e-33 126 36 4 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
Q6NDQ0 4.46e-33 126 36 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q6HLQ9 4.66e-33 125 35 3 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q65UE1 4.78e-33 126 37 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q0RT43 4.92e-33 124 36 3 191 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q7NX01 5.57e-33 126 36 5 208 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1LNM0 5.84e-33 124 39 3 194 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q0K9I2 6.26e-33 124 39 4 197 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q0BFQ0 6.29e-33 125 35 4 204 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
P9WQM1 7.93e-33 125 37 3 204 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQM0 7.93e-33 125 37 3 204 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4W3 7.93e-33 125 37 3 204 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q81TH8 7.95e-33 125 35 3 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus anthracis
Q8RI39 8.38e-33 125 38 3 203 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q6D4E2 8.85e-33 126 39 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q4K441 8.93e-33 123 36 2 187 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q13ER6 9.5e-33 125 36 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Rhodopseudomonas palustris (strain BisB5)
Q2K4V4 9.74e-33 125 35 5 228 3 ugpC2 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q1B8U4 1.02e-32 122 37 3 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycobacterium sp. (strain MCS)
Q9X196 1.06e-32 125 37 4 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q7NQN5 1.11e-32 125 36 3 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2SJY7 1.22e-32 125 37 1 192 3 potA Spermidine/putrescine import ATP-binding protein PotA Hahella chejuensis (strain KCTC 2396)
Q609Q1 1.35e-32 124 36 6 206 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q39GW5 1.44e-32 124 36 5 202 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0K998 1.48e-32 125 35 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8F6Z1 1.56e-32 124 34 7 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 1.56e-32 124 34 7 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q49WM4 1.85e-32 124 38 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8U4K3 1.9e-32 124 37 5 204 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q7NIW1 1.96e-32 124 36 4 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
P14788 2.41e-32 124 36 3 202 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q81GC1 2.6e-32 123 34 3 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q7A169 2.61e-32 124 41 2 174 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MW2)
Q6GAB5 2.61e-32 124 41 2 174 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MSSA476)
Q6GHY6 2.61e-32 124 41 2 174 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MRSA252)
Q7A679 2.61e-32 124 41 2 174 1 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain N315)
Q99V03 2.61e-32 124 41 2 174 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGY5 2.61e-32 124 41 2 174 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain COL)
Q2YX74 2.61e-32 124 41 2 174 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2A7 2.61e-32 124 41 2 174 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHY1 2.61e-32 124 41 2 174 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain USA300)
Q5LT05 2.65e-32 124 35 5 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q1AS06 2.84e-32 124 37 4 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q2YAD6 3.22e-32 124 37 3 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q0I2Z4 3.81e-32 123 34 3 214 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Histophilus somni (strain 129Pt)
Q32EY4 3.82e-32 124 38 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella dysenteriae serotype 1 (strain Sd197)
Q46ZU5 4.21e-32 122 39 2 187 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q9CP06 4.29e-32 124 37 3 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
A1B9H9 4.37e-32 120 33 4 203 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Paracoccus denitrificans (strain Pd 1222)
Q89WG0 5.08e-32 123 36 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8XZQ4 5.74e-32 121 38 2 194 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2L0H5 6.19e-32 123 36 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bordetella avium (strain 197N)
Q65S66 7.01e-32 123 33 3 214 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q48CA0 7.59e-32 121 36 2 187 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q0TJC1 8.2e-32 120 32 4 226 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8Z1U0 8.2e-32 123 34 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Salmonella typhi
Q1MCN6 8.29e-32 123 35 5 228 3 ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P19566 8.46e-32 123 34 4 228 1 malK Maltose/maltodextrin import ATP-binding protein MalK Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57GZ7 8.46e-32 123 34 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Salmonella choleraesuis (strain SC-B67)
Q0T5R2 8.86e-32 123 37 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri serotype 5b (strain 8401)
Q4ZLS1 9.58e-32 120 36 2 187 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. syringae (strain B728a)
Q8KZQ6 1.01e-31 120 35 2 187 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida
Q13ZK7 1.05e-31 122 33 5 220 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Paraburkholderia xenovorans (strain LB400)
E0SCY1 1.11e-31 123 36 5 211 1 ousV Glycine betaine/choline transport system ATP-binding protein OusV Dickeya dadantii (strain 3937)
Q46ZM0 1.13e-31 122 34 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8UB29 1.19e-31 122 36 4 222 3 ugpC3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 Agrobacterium fabrum (strain C58 / ATCC 33970)
P44531 1.22e-31 122 34 3 214 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q881U6 1.25e-31 119 35 4 195 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3Z2Z3 1.31e-31 122 37 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella sonnei (strain Ss046)
Q31ZK0 1.31e-31 122 37 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella boydii serotype 4 (strain Sb227)
Q6FFZ1 1.46e-31 120 36 4 209 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q60AI1 1.47e-31 122 39 3 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q98HF7 1.61e-31 122 36 4 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q72FW5 1.74e-31 122 37 3 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q73YZ5 1.74e-31 119 33 4 209 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QFE1 1.74e-31 119 33 4 209 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycobacterium avium (strain 104)
Q28QL7 1.75e-31 122 35 6 229 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Jannaschia sp. (strain CCS1)
P69877 1.77e-31 122 37 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri
P69874 1.77e-31 122 37 3 197 1 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain K12)
P69875 1.77e-31 122 37 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIU8 1.77e-31 122 37 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P69876 1.77e-31 122 37 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O157:H7
Q98G42 1.81e-31 122 35 5 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P56344 1.82e-31 119 39 3 199 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q1RD28 2.01e-31 122 37 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain UTI89 / UPEC)
A1AA20 2.01e-31 122 37 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O1:K1 / APEC
Q8XBJ8 2.23e-31 122 36 3 195 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
P9WQI3 2.29e-31 122 35 2 209 1 sugC Trehalose import ATP-binding protein SugC Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQI2 2.29e-31 122 35 2 209 3 sugC Trehalose import ATP-binding protein SugC Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q5PKZ8 2.32e-31 122 34 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P16676 2.38e-31 122 36 3 195 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q8FFB3 2.43e-31 122 36 3 195 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9KS33 2.69e-31 122 37 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6D201 2.72e-31 120 35 6 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2J2E9 2.76e-31 121 36 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Rhodopseudomonas palustris (strain HaA2)
Q668K6 3.07e-31 121 36 3 195 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q9MUN1 3.17e-31 121 36 2 202 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q3K506 3.19e-31 119 35 2 187 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas fluorescens (strain Pf0-1)
P37009 3.21e-31 121 35 2 203 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli (strain K12)
Q110U3 3.25e-31 122 38 3 199 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
Q88R93 3.26e-31 119 35 2 187 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A0A0H2ZLL3 3.28e-31 118 38 6 223 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q7AH43 3.31e-31 121 35 2 203 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli O157:H7
Q87UI3 3.37e-31 119 36 2 187 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q03ZQ0 3.63e-31 121 38 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q1RDS4 3.69e-31 119 32 4 226 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli (strain UTI89 / UPEC)
A1A9L0 3.69e-31 119 32 4 226 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O1:K1 / APEC
Q5PMK1 3.85e-31 121 36 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P40790 3.93e-31 121 36 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57QC8 3.93e-31 121 36 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella choleraesuis (strain SC-B67)
Q8E8K8 4.21e-31 120 38 6 205 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
O83658 4.21e-31 121 37 3 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Treponema pallidum (strain Nichols)
A1TXH7 4.51e-31 121 37 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
P45171 4.67e-31 121 36 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8Z7H7 4.84e-31 121 36 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhi
Q8U8D6 5.22e-31 119 31 6 224 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8DIA0 5.24e-31 120 35 4 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q0SXQ1 5.32e-31 121 33 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Shigella flexneri serotype 5b (strain 8401)
Q4KGX6 6.94e-31 118 38 5 192 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q5E586 8.09e-31 120 36 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q160M2 8.77e-31 120 38 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q0I3Y9 8.79e-31 120 36 3 199 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q5YRK2 8.82e-31 117 37 7 207 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Nocardia farcinica (strain IFM 10152)
Q7WID6 9.46e-31 120 35 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A1SWH9 9.8e-31 120 34 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q7VYN2 1.01e-30 120 35 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8Z4V6 1.06e-30 120 36 3 195 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
Q9I6T2 1.11e-30 120 36 3 201 3 potA1 Spermidine/putrescine import ATP-binding protein PotA 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P74548 1.12e-30 120 34 2 207 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6CZ34 1.13e-30 120 36 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7NRX5 1.18e-30 120 36 5 225 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7UC29 1.2e-30 120 36 3 195 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
O85818 1.25e-30 120 37 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q8FB37 1.26e-30 120 33 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q65QT6 1.26e-30 120 34 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7UBD0 1.29e-30 120 33 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Shigella flexneri
P40860 1.3e-30 120 36 3 195 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q3YUV0 1.31e-30 120 33 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Shigella sonnei (strain Ss046)
Q1R3Q1 1.31e-30 120 33 4 228 1 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli (strain UTI89 / UPEC)
P68187 1.31e-30 120 33 4 228 1 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli (strain K12)
P68188 1.31e-30 120 33 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli O157:H7
Q0TA26 1.32e-30 120 34 6 231 3 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q07UI9 1.32e-30 119 35 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Rhodopseudomonas palustris (strain BisA53)
Q5YZY9 1.34e-30 119 38 2 202 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nocardia farcinica (strain IFM 10152)
Q0AGF4 1.41e-30 119 36 4 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q8FJ95 1.43e-30 117 32 4 226 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9KL04 1.5e-30 120 33 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8D0W8 1.68e-30 119 35 3 195 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pestis
P17328 1.69e-30 120 33 3 209 2 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7N6Z2 1.76e-30 119 36 3 194 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q4QK57 1.97e-30 119 36 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q4KC87 2.41e-30 119 35 6 220 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A3PRY1 2.64e-30 119 36 2 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q47YG8 2.74e-30 116 36 1 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q92UV5 2.79e-30 119 37 4 208 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhizobium meliloti (strain 1021)
Q326G9 2.83e-30 115 35 7 214 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella boydii serotype 4 (strain Sb227)
Q48IB9 3.16e-30 115 35 4 195 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q7W6G5 3.21e-30 119 36 4 210 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q0TC10 3.47e-30 118 36 4 227 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FCQ2 3.58e-30 118 36 4 227 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1R5H8 3.69e-30 118 36 4 227 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Escherichia coli (strain UTI89 / UPEC)
A1AGY1 3.69e-30 118 36 4 227 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Escherichia coli O1:K1 / APEC
Q9K9G7 3.73e-30 116 32 6 222 3 thiZ Formylaminopyrimidine import ATP-binding protein ThiZ Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q92WD6 3.91e-30 118 36 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Rhizobium meliloti (strain 1021)
Q21CA3 3.92e-30 118 35 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Rhodopseudomonas palustris (strain BisB18)
O86751 3.97e-30 118 35 3 205 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9CM80 4.39e-30 118 32 3 214 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pasteurella multocida (strain Pm70)
O57896 4.4e-30 118 35 5 208 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q83MG3 4.57e-30 115 34 6 214 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella flexneri
O34392 5.22e-30 115 36 1 184 2 ytrE ABC transporter ATP-binding protein YtrE Bacillus subtilis (strain 168)
P14175 5.44e-30 119 33 3 209 1 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Escherichia coli (strain K12)
Q73XU8 6.24e-30 118 35 3 204 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q9HYF9 6.68e-30 115 35 2 200 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02QT6 6.68e-30 115 35 2 200 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8X6U5 7.1e-30 117 35 4 227 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Escherichia coli O157:H7
Q0T8D1 8.18e-30 114 35 7 214 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella flexneri serotype 5b (strain 8401)
P10907 8.29e-30 117 35 4 227 1 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Escherichia coli (strain K12)
Q981Y8 8.32e-30 115 37 3 193 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q31VH5 8.73e-30 117 35 4 227 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Shigella boydii serotype 4 (strain Sb227)
Q8FW07 8.81e-30 117 34 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella suis biovar 1 (strain 1330)
Q578E9 8.81e-30 117 34 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella abortus biovar 1 (strain 9-941)
P18813 8.95e-30 116 34 7 231 3 malK Maltose/maltodextrin import ATP-binding protein MalK (Fragment) Klebsiella aerogenes
Q3YW77 9.29e-30 117 35 4 227 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Shigella sonnei (strain Ss046)
Q87PH3 9.71e-30 117 36 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q2YKR8 9.88e-30 117 34 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella abortus (strain 2308)
Q87GB5 9.97e-30 117 33 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8XZX8 1.01e-29 117 33 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q13RD3 1.13e-29 114 35 5 207 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Paraburkholderia xenovorans (strain LB400)
Q6LK87 1.19e-29 117 32 5 234 3 malK Maltose/maltodextrin import ATP-binding protein MalK Photobacterium profundum (strain SS9)
Q82CD3 1.25e-29 114 32 8 222 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q4K681 1.3e-29 117 33 5 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8UBB7 1.31e-29 117 34 4 222 3 ugpC2 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q82WT5 1.31e-29 117 34 7 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q2JGF5 1.34e-29 115 33 3 191 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q7MFC4 1.53e-29 117 33 4 230 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio vulnificus (strain YJ016)
Q8D3V0 1.53e-29 117 33 4 230 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio vulnificus (strain CMCP6)
Q8XA06 1.54e-29 114 35 7 214 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O157:H7
Q8YCB1 1.62e-29 116 34 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q13GD4 1.63e-29 114 35 5 207 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Paraburkholderia xenovorans (strain LB400)
Q6MCV4 1.77e-29 117 37 6 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Protochlamydia amoebophila (strain UWE25)
Q8Z0H0 1.83e-29 116 35 3 203 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q32K28 1.91e-29 114 34 7 214 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella dysenteriae serotype 1 (strain Sd197)
Q92VJ2 2.08e-29 116 36 5 202 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q3IX40 2.19e-29 116 35 2 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q92WJ0 2.34e-29 116 37 2 189 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q66FU4 2.37e-29 116 35 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q9V2C0 2.42e-29 116 33 3 205 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus abyssi (strain GE5 / Orsay)
Q7MKU3 2.45e-29 116 36 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 2.45e-29 116 36 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
Q83LN2 2.61e-29 114 31 3 226 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Shigella flexneri
Q85A69 2.74e-29 116 34 1 190 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Anthoceros angustus
Q0T6A8 2.84e-29 114 31 3 226 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Shigella flexneri serotype 5b (strain 8401)
Q5JEB0 2.91e-29 115 35 5 208 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9YGA6 3.03e-29 116 33 3 208 1 malK Trehalose/maltose import ATP-binding protein MalK Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
Q3Z5U5 3.04e-29 113 34 7 214 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella sonnei (strain Ss046)
Q6LR20 3.13e-29 116 36 2 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
P46920 3.17e-29 117 34 2 208 1 opuAA Glycine betaine transport ATP-binding protein OpuAA Bacillus subtilis (strain 168)
Q3Z3I7 3.46e-29 113 31 3 226 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Shigella sonnei (strain Ss046)
Q8Z8W8 3.53e-29 116 36 4 207 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhi
Q8UBY6 3.58e-29 113 32 4 223 3 thiQ Thiamine import ATP-binding protein ThiQ Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8PC11 3.65e-29 115 34 4 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q5PFQ7 3.67e-29 116 36 4 207 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8U648 3.79e-29 113 33 1 187 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q7N986 3.95e-29 115 32 4 228 3 malK Maltose/maltodextrin import ATP-binding protein MalK Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1CDR0 4.11e-29 114 34 4 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Nepal516)
Q74PI5 4.11e-29 114 34 4 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis
Q1C1S0 4.11e-29 114 34 4 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Antiqua)
P55453 4.19e-29 115 33 4 218 3 NGR_a03670 Uncharacterized ABC transporter ATP-binding protein y4fO Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0AAI1 4.28e-29 113 31 3 226 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli (strain K12)
P0AAI2 4.28e-29 113 31 3 226 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O157:H7
A1BC20 4.58e-29 113 38 7 205 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Paracoccus denitrificans (strain Pd 1222)
Q665B6 4.87e-29 113 34 4 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pseudotuberculosis serotype I (strain IP32953)
Q7N8B9 5.86e-29 115 33 2 203 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2K8C8 5.94e-29 115 36 2 189 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8NR42 6.33e-29 112 37 6 194 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A1JIE0 6.71e-29 115 34 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8UH62 6.78e-29 115 35 5 203 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q5PDF8 7.21e-29 112 37 5 186 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q3KCC5 7.4e-29 115 34 6 223 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain Pf0-1)
Q9HZL7 7.85e-29 112 32 4 223 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6D734 8.05e-29 115 34 2 203 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q578K3 8.79e-29 114 36 2 189 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus biovar 1 (strain 9-941)
Q2YKX3 8.79e-29 114 36 2 189 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus (strain 2308)
Q8U6M1 9.35e-29 114 37 2 189 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Agrobacterium fabrum (strain C58 / ATCC 33970)
A1B9Q7 9.45e-29 114 37 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Paracoccus denitrificans (strain Pd 1222)
P63354 9.48e-29 114 35 6 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella suis biovar 1 (strain 1330)
P63353 9.48e-29 114 35 6 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q1CNC6 9.57e-29 114 34 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Yersinia pestis bv. Antiqua (strain Nepal516)
Q74R28 9.57e-29 114 34 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Yersinia pestis
Q1CBH2 9.57e-29 114 34 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Yersinia pestis bv. Antiqua (strain Antiqua)
A0LUE6 9.68e-29 115 34 4 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q2SU77 1.1e-28 114 35 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8PNN4 1.16e-28 114 33 3 206 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas axonopodis pv. citri (strain 306)
Q7NWX3 1.18e-28 114 37 4 202 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9KLQ5 1.2e-28 114 32 3 219 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P31548 1.55e-28 111 35 8 221 1 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli (strain K12)
Q8PHQ3 1.68e-28 112 34 4 189 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Xanthomonas axonopodis pv. citri (strain 306)
P55604 1.79e-28 114 32 4 222 3 NGR_a02170 Uncharacterized ABC transporter ATP-binding protein y4oS Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P54933 1.85e-28 113 33 4 222 3 smoK ATP-binding transport protein SmoK Cereibacter sphaeroides
Q97UY8 1.89e-28 114 32 4 228 1 glcV Glucose import ATP-binding protein GlcV Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P96063 2.07e-28 114 36 4 207 2 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9PDN2 2.26e-28 113 36 3 206 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
A1TAI4 2.49e-28 114 35 3 204 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q9RR46 2.53e-28 114 33 1 206 1 gbuA Glycine betaine/carnitine transport ATP-binding protein GbuA Listeria monocytogenes serotype 1/2a (strain 10403S)
Q8YCG3 2.63e-28 113 36 2 189 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q62GB4 2.67e-28 113 35 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Burkholderia mallei (strain ATCC 23344)
P10091 2.75e-28 114 33 2 203 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Marchantia polymorpha
Q9KIF7 2.91e-28 114 33 2 203 3 opuAA Glycine betaine transport ATP-binding protein OpuAA Lactococcus lactis subsp. lactis (strain IL1403)
Q57TF5 3.1e-28 110 36 5 185 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella choleraesuis (strain SC-B67)
A1URR2 3.31e-28 113 34 4 222 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q57SD6 3.33e-28 113 35 4 207 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella choleraesuis (strain SC-B67)
Q57293 3.37e-28 113 32 3 214 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Actinobacillus pleuropneumoniae
Q8ZRV2 3.56e-28 110 37 5 186 1 thiQ Thiamine import ATP-binding protein ThiQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8FL82 3.57e-28 110 34 7 214 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FVV5 3.58e-28 113 36 2 189 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella suis biovar 1 (strain 1330)
Q8Z9I6 3.95e-28 110 36 5 186 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella typhi
Q8RLB6 4.04e-28 110 35 3 189 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Delftia acidovorans
Q7CS28 4.08e-28 113 32 3 209 1 smoE Sulfoquinovosyl glycerol transport ATP-binding protein SmoE Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0TLS2 4.18e-28 110 34 7 214 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q63Q62 4.61e-28 113 35 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Burkholderia pseudomallei (strain K96243)
Q47T99 4.76e-28 113 36 3 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermobifida fusca (strain YX)
Q3JMW7 4.81e-28 112 35 3 209 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Burkholderia pseudomallei (strain 1710b)
Q5PJL1 4.91e-28 112 34 4 227 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Salmonella paratyphi A (strain ATCC 9150 / SARB42)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11755
Feature type CDS
Gene -
Product ATP-binding cassette domain-containing protein
Location 499202 - 499975 (strand: -1)
Length 774 (nucleotides) / 257 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2595
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4525 Inorganic ion transport and metabolism (P) P ABC-type taurine transport system, ATPase component

Protein Sequence

MADIILKNIDFFYPDKPQIILSDVNLTIPDNGITVVLGASGCGKTSLLNIVAGFLSPSGGEITQDGKIIYGPASDRAVVFQNDALMPWLNVYENVALGLQIKNSGKQEETAIVKEKLQDTGLLHVITDNIWSLSGGMRQRVGIARALAIESDFILMDEPFGALDAANREQMQSLILTLKKNRQSAFFIITHDIEETLLLATNLILMAPNPGRIISVEEPPFYKHWSDGMTIRQIKSDQSFIHYRDYLSDKIMAHKCS

Flanking regions ( +/- flanking 50bp)

TGCCGAAAATATCAGTATACAGGCCATTGAAACGGCAAAGGAACAATAATATGGCTGATATTATTCTTAAAAATATTGATTTTTTTTACCCCGATAAACCACAAATCATATTATCTGATGTGAATTTAACTATACCTGATAATGGTATTACGGTTGTACTGGGAGCCTCCGGTTGCGGTAAAACATCGTTGCTGAATATTGTGGCCGGTTTTTTATCTCCGTCCGGGGGGGAAATAACACAGGACGGAAAAATAATTTATGGCCCGGCATCAGACAGAGCGGTGGTATTTCAAAATGATGCACTTATGCCCTGGCTCAATGTTTATGAAAATGTCGCACTGGGGCTGCAAATTAAAAATTCAGGGAAACAGGAAGAAACCGCAATTGTAAAAGAGAAACTGCAGGATACAGGGCTGCTTCATGTTATTACGGATAATATCTGGTCATTATCCGGAGGAATGCGGCAACGGGTTGGTATTGCGCGGGCATTGGCCATTGAATCTGATTTTATTTTGATGGATGAACCCTTTGGGGCGCTGGATGCCGCTAACCGTGAACAAATGCAATCATTAATTCTGACATTGAAAAAAAACCGGCAGAGTGCTTTCTTTATTATTACACATGATATTGAAGAAACCCTTCTTCTGGCCACGAATCTGATATTAATGGCGCCAAATCCGGGACGAATAATATCCGTTGAAGAACCACCATTTTATAAACACTGGTCAGACGGTATGACTATTCGTCAGATAAAATCTGACCAGAGTTTTATTCATTACAGAGATTACCTGTCCGATAAAATAATGGCACACAAGTGCAGTTAATTAACCGGTTAATAATGCAGATGCAGAGCATATACCATATTGTCAGAAAA