Homologs in group_743

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03305 FBDBKF_03305 80.6 Morganella morganii S1 barS Barstar, RNAse (barnase) inhibitor
EHELCC_07230 EHELCC_07230 80.6 Morganella morganii S2 barS Barstar, RNAse (barnase) inhibitor
NLDBIP_07555 NLDBIP_07555 80.6 Morganella morganii S4 barS Barstar, RNAse (barnase) inhibitor
LHKJJB_07090 LHKJJB_07090 80.6 Morganella morganii S3 barS Barstar, RNAse (barnase) inhibitor
HKOGLL_03840 HKOGLL_03840 80.6 Morganella morganii S5 barS Barstar, RNAse (barnase) inhibitor
PMI_RS18110 PMI_RS18110 44.4 Proteus mirabilis HI4320 - barstar family protein

Distribution of the homologs in the orthogroup group_743

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_743

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64616 2.74e-11 58 37 1 86 3 yhcO Uncharacterized protein YhcO Escherichia coli (strain K12)
P64617 2.74e-11 58 37 1 86 3 yhcO Uncharacterized protein YhcO Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64618 2.74e-11 58 37 1 86 1 yhcO Uncharacterized protein YhcO Escherichia coli O157:H7
O07938 3.87e-07 47 30 1 88 3 yrdF Putative ribonuclease inhibitor YrdF Bacillus subtilis (strain 168)
P11540 2.19e-06 45 30 2 91 1 None Barstar Bacillus amyloliquefaciens

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11630
Feature type CDS
Gene -
Product barstar family protein
Location 479092 - 479421 (strand: 1)
Length 330 (nucleotides) / 109 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_743
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01337 Barstar (barnase inhibitor)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2732 Transcription (K) K Barstar, RNAse (barnase) inhibitor

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03623 ribonuclease inhibitor - -

Protein Sequence

MTDETNTTGTNTAEINRVHFDFRMIRTTEDFYQQFSDKFQLVAGFGHNTDALWDMLTGAIELPVTLVFEHITARQRRLFSAVIATCRDAEEEWPGDIQLILTPLTMRAD

Flanking regions ( +/- flanking 50bp)

TTTATGTGACAACAGATCATTACCGCTCATTTCAGAAGGCAGGATAATGCATGACGGATGAGACAAACACGACCGGGACAAACACGGCTGAGATAAACAGAGTGCATTTTGATTTCCGTATGATCCGGACCACAGAGGATTTTTATCAGCAATTCAGTGATAAATTTCAGTTGGTTGCGGGTTTTGGTCATAACACGGATGCATTATGGGATATGTTAACGGGCGCAATTGAGTTGCCTGTAACGCTGGTGTTTGAGCATATTACTGCGCGTCAGCGGCGGTTGTTCTCGGCGGTGATTGCCACCTGTCGTGATGCAGAGGAAGAGTGGCCGGGGGATATTCAGCTGATACTGACCCCCCTGACCATGCGGGCGGATTAAGCGGTTTCAGCCAGTTCTTTCAGATACTGGAACAACTGGCGGTACGCTTT