Homologs in group_814

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03305 FBDBKF_03305 100.0 Morganella morganii S1 barS Barstar, RNAse (barnase) inhibitor
EHELCC_07230 EHELCC_07230 100.0 Morganella morganii S2 barS Barstar, RNAse (barnase) inhibitor
NLDBIP_07555 NLDBIP_07555 100.0 Morganella morganii S4 barS Barstar, RNAse (barnase) inhibitor
HKOGLL_03840 HKOGLL_03840 100.0 Morganella morganii S5 barS Barstar, RNAse (barnase) inhibitor
F4V73_RS11630 F4V73_RS11630 80.6 Morganella psychrotolerans - barstar family protein
PMI_RS18110 PMI_RS18110 46.2 Proteus mirabilis HI4320 - barstar family protein

Distribution of the homologs in the orthogroup group_814

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_814

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64616 1.68e-09 53 36 2 85 3 yhcO Uncharacterized protein YhcO Escherichia coli (strain K12)
P64617 1.68e-09 53 36 2 85 3 yhcO Uncharacterized protein YhcO Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64618 1.68e-09 53 36 2 85 1 yhcO Uncharacterized protein YhcO Escherichia coli O157:H7
P11540 6.75e-07 46 33 3 81 1 None Barstar Bacillus amyloliquefaciens
O07938 3.97e-06 44 29 2 84 3 yrdF Putative ribonuclease inhibitor YrdF Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_07090
Feature type CDS
Gene barS
Product Barstar, RNAse (barnase) inhibitor
Location 149861 - 150157 (strand: 1)
Length 297 (nucleotides) / 98 (amino acids)
In genomic island -

Contig

Accession ZDB_363
Length 233386 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_814
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01337 Barstar (barnase inhibitor)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2732 Transcription (K) K Barstar, RNAse (barnase) inhibitor

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03623 ribonuclease inhibitor - -

Protein Sequence

MTPDISIVRFDFRTIRTTDDFYQQFSDKFQLPYFGCNTDALWDMLTGGIDLPVILAFEHITARQRRLFSAIIGTCRDAEEEWPGDIQLVLTPLTMTAD

Flanking regions ( +/- flanking 50bp)

TTTATGTCACCACTGATCATTACCGTTCGTTTCAGCAGGCCAATTAACCCATGACACCTGATATCAGCATTGTGCGTTTTGACTTCCGCACCATCCGGACAACAGACGATTTTTATCAGCAATTCAGTGATAAATTTCAGCTGCCGTACTTCGGGTGTAACACGGATGCACTGTGGGATATGCTGACAGGCGGGATTGATCTGCCGGTGATACTGGCGTTTGAACATATTACCGCACGGCAGCGGCGGCTGTTTTCAGCCATTATCGGTACCTGCCGGGATGCGGAAGAAGAGTGGCCGGGGGATATTCAGCTGGTGCTGACCCCCCTGACCATGACGGCGGATTAAGCGCTTTCTGCCAGTTCTTTCAGATACTGGAACAGCTGGCGGTAAGCTTT