Homologs in group_2607

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03475 FBDBKF_03475 96.8 Morganella morganii S1 livH high-affinity branched-chain amino acid ABC transporter permease LivH
EHELCC_07060 EHELCC_07060 96.8 Morganella morganii S2 livH high-affinity branched-chain amino acid ABC transporter permease LivH
NLDBIP_07385 NLDBIP_07385 96.8 Morganella morganii S4 livH high-affinity branched-chain amino acid ABC transporter permease LivH
LHKJJB_06920 LHKJJB_06920 96.8 Morganella morganii S3 livH high-affinity branched-chain amino acid ABC transporter permease LivH
HKOGLL_04010 HKOGLL_04010 96.8 Morganella morganii S5 livH high-affinity branched-chain amino acid ABC transporter permease LivH

Distribution of the homologs in the orthogroup group_2607

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2607

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEX7 0.0 509 84 0 308 1 livH High-affinity branched-chain amino acid transport system permease protein LivH Escherichia coli (strain K12)
P0AEX8 0.0 509 84 0 308 3 livH High-affinity branched-chain amino acid transport system permease protein LivH Escherichia coli O157:H7
P0A2J1 0.0 507 84 0 308 3 livH High-affinity branched-chain amino acid transport system permease protein LivH Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J2 0.0 507 84 0 308 3 livH High-affinity branched-chain amino acid transport system permease protein LivH Salmonella typhi
P21627 2.26e-131 378 68 0 306 3 braD High-affinity branched-chain amino acid transport system permease protein BraD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q58665 7.94e-10 62 33 2 131 3 livH Probable branched-chain amino acid transport permease protein LivH Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A1JJ54 5.27e-06 51 31 4 164 3 lsrC Autoinducer 2 import system permease protein LsrC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JLQ1 6.52e-06 50 30 3 139 3 lsrC Autoinducer 2 import system permease protein LsrC Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FMJ8 8.4e-06 50 31 2 138 3 lsrC Autoinducer 2 import system permease protein LsrC Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7N2D8 8.45e-06 50 26 4 169 3 lsrC Autoinducer 2 import system permease protein LsrC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2PBM2 1.02e-05 50 26 4 168 3 lsrC Autoinducer 2 import system permease protein LsrC Photorhabdus temperata
A4TQL6 1.14e-05 50 30 3 139 3 lsrC Autoinducer 2 import system permease protein LsrC Yersinia pestis (strain Pestoides F)
Q1CN16 1.14e-05 50 30 3 139 3 lsrC Autoinducer 2 import system permease protein LsrC Yersinia pestis bv. Antiqua (strain Nepal516)
A9R075 1.14e-05 50 30 3 139 3 lsrC Autoinducer 2 import system permease protein LsrC Yersinia pestis bv. Antiqua (strain Angola)
Q7CG49 1.14e-05 50 30 3 139 3 lsrC Autoinducer 2 import system permease protein LsrC Yersinia pestis
Q1C137 1.14e-05 50 30 3 139 3 lsrC Autoinducer 2 import system permease protein LsrC Yersinia pestis bv. Antiqua (strain Antiqua)
Q66EZ0 1.37e-05 49 30 3 139 3 lsrC Autoinducer 2 import system permease protein LsrC Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K3G0 1.37e-05 49 30 3 139 3 lsrC Autoinducer 2 import system permease protein LsrC Yersinia pseudotuberculosis serotype IB (strain PB1/+)
P22729 3.88e-05 48 30 4 131 3 livM High-affinity branched-chain amino acid transport system permease protein LivM Escherichia coli (strain K12)
P30296 4.09e-05 48 30 4 131 3 livM High-affinity branched-chain amino acid transport system permease protein LivM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AGI7 5.1e-05 48 30 2 117 3 xylH Xylose transport system permease protein XylH Shigella flexneri
P0AGI4 5.1e-05 48 30 2 117 1 xylH Xylose transport system permease protein XylH Escherichia coli (strain K12)
P0AGI5 5.1e-05 48 30 2 117 3 xylH Xylose transport system permease protein XylH Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGI6 5.1e-05 48 30 2 117 3 xylH Xylose transport system permease protein XylH Escherichia coli O157:H7
Q2PBL9 0.00014 46 28 5 155 3 lsrC Autoinducer 2 import system permease protein LsrC Photorhabdus luminescens
P21628 0.000521 45 31 6 137 3 braE High-affinity branched-chain amino acid transport system permease protein BraE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9F9B1 0.000581 44 34 1 92 1 frcC Fructose import permease protein FrcC Rhizobium meliloti

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11420
Feature type CDS
Gene livH
Product high-affinity branched-chain amino acid ABC transporter permease LivH
Location 427254 - 428180 (strand: 1)
Length 927 (nucleotides) / 308 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2607
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF02653 Branched-chain amino acid transport system / permease component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0559 Amino acid transport and metabolism (E) E Branched-chain amino acid ABC-type transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01997 branched-chain amino acid transport system permease protein ABC transporters
Quorum sensing		 -

Protein Sequence

MSEQLLYFTQQLLNGLTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVSFIVIAGLMMLGIDVGWLLITAAFITAIVISSAYGWSIERVAYRPVRHSKRLIALISAIGMSIFLQNFVSLSQGSRDLALPGLIEGRWTLGESGGFAATVSAMQITIWAVTVLAMLALTLFIRYSRMGRACRACAEDLKMAGLLGINTDRVIALTFVIGAAMAAVAGVLLGQFYGVINPYIGFMAGMKAFTAAVLGGIGSIPGAMIGGLILGVSEAMTSAYFSTEYKDVVSFSLLIIVLLVMPTGILGRPEVEKV

Flanking regions ( +/- flanking 50bp)

CTGATCCGCCTCAGTAACTTATGCAGGCCGTGTATTTCAGGGAGTGCGCTATGTCAGAACAATTATTATATTTTACGCAGCAATTATTGAACGGATTAACGCTGGGAAGCACTTACGCTCTGATCGCTATCGGTTACACGATGGTGTACGGCATTATCGGCATGATCAACTTTGCTCACGGCGAAGTTTATATGATTGGCAGTTACGTCTCGTTTATCGTGATTGCCGGTCTGATGATGCTGGGGATTGATGTCGGCTGGTTGCTGATAACCGCCGCATTTATTACCGCAATTGTGATTTCATCAGCGTATGGCTGGAGTATTGAACGGGTCGCATACCGGCCTGTCCGTCACTCAAAGCGGCTGATCGCGCTGATTTCGGCAATAGGAATGTCCATTTTTCTTCAGAACTTTGTCAGTCTGTCGCAAGGCTCGCGTGATCTCGCGCTGCCCGGGCTGATTGAGGGGCGCTGGACACTGGGCGAGAGCGGCGGGTTCGCCGCGACTGTCTCCGCCATGCAGATAACCATCTGGGCAGTGACTGTGCTGGCAATGCTGGCGCTGACTCTGTTTATCCGCTATTCCCGCATGGGACGGGCGTGTCGCGCCTGCGCGGAAGATCTGAAAATGGCAGGTTTGCTCGGGATCAATACCGATCGCGTGATCGCGCTGACCTTTGTGATCGGCGCGGCAATGGCGGCGGTCGCCGGAGTCCTGTTAGGTCAGTTCTATGGCGTGATCAATCCGTACATTGGCTTTATGGCCGGTATGAAAGCCTTTACCGCAGCCGTTCTCGGCGGGATCGGCAGTATTCCCGGAGCCATGATCGGCGGGCTGATCCTCGGTGTTTCCGAAGCGATGACCTCTGCGTATTTCAGTACGGAATACAAAGATGTGGTTTCATTCAGCTTGCTGATTATTGTGCTGCTGGTGATGCCGACCGGGATCTTAGGGCGTCCGGAGGTTGAGAAAGTATGACAAAATCTCACTGGGTAAACGCCATTATCGCCACTGTGACGCTGTTTGTT