Homologs in group_1492

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08945 FBDBKF_08945 96.4 Morganella morganii S1 phnA Uncharacterized Zn-ribbon-containing protein
EHELCC_10465 EHELCC_10465 96.4 Morganella morganii S2 phnA Uncharacterized Zn-ribbon-containing protein
NLDBIP_10810 NLDBIP_10810 96.4 Morganella morganii S4 phnA Uncharacterized Zn-ribbon-containing protein
LHKJJB_10545 LHKJJB_10545 96.4 Morganella morganii S3 phnA Uncharacterized Zn-ribbon-containing protein
HKOGLL_13605 HKOGLL_13605 96.4 Morganella morganii S5 phnA Uncharacterized Zn-ribbon-containing protein
PMI_RS00410 PMI_RS00410 94.6 Proteus mirabilis HI4320 - zinc ribbon domain-containing protein YjdM

Distribution of the homologs in the orthogroup group_1492

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1492

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFJ4 6.8e-71 209 90 0 111 3 yjdM Protein YjdM Shigella flexneri
P0AFJ1 6.8e-71 209 90 0 111 3 yjdM Protein YjdM Escherichia coli (strain K12)
P0AFJ2 6.8e-71 209 90 0 111 3 yjdM Protein YjdM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFJ3 6.8e-71 209 90 0 111 3 yjdM Protein YjdM Escherichia coli O157:H7
Q02419 2.85e-53 165 73 1 110 3 yjdM Protein YjdM Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P44479 2.59e-42 137 59 2 111 3 yjdM Protein YjdM homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11025
Feature type CDS
Gene -
Product zinc ribbon domain-containing protein YjdM
Location 344016 - 344351 (strand: -1)
Length 336 (nucleotides) / 111 (amino acids)
In genomic island GI66

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1492
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03831 PhnA domain
PF08274 PhnA Zinc-Ribbon

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2824 General function prediction only (R) R Uncharacterized Zn-ribbon-containing protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06193 protein PhnA - -

Protein Sequence

MSLPSCPKCNSEYTYEDGAMYVCPECAHEWNDAEPAADSDELIVKDANGNLLADGDSVTVIKDLKVKGSSSMLKIGTKVKSIRLVEGDHNIDCKIDGFGQMKLKSEFVKKS

Flanking regions ( +/- flanking 50bp)

ATGACGTGACAGTTTGCTGCTCCCCATTGTAAAAATCTGAGAGTCTCATTATGTCATTACCTTCATGCCCGAAATGTAATTCTGAATACACTTATGAAGATGGTGCAATGTATGTATGCCCTGAATGCGCCCACGAGTGGAATGATGCTGAACCGGCAGCAGACAGCGACGAGCTTATTGTCAAAGATGCCAACGGTAATTTACTGGCAGACGGCGACAGCGTGACAGTGATTAAAGATCTGAAAGTCAAAGGCAGTTCTTCCATGCTGAAAATCGGCACAAAAGTCAAAAGCATTCGTTTAGTCGAAGGCGACCATAATATCGATTGTAAAATCGATGGCTTTGGTCAGATGAAACTGAAATCTGAGTTTGTGAAAAAGAGCTGATTCTCTTTCCTGAAAAGATTGCTGACAACATCCCCGCCTGTTTTTTCAGG