Homologs in group_2824

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09250 FBDBKF_09250 93.3 Morganella morganii S1 bltR2 GyrI-like small molecule binding domain
EHELCC_10160 EHELCC_10160 93.3 Morganella morganii S2 bltR2 GyrI-like small molecule binding domain
NLDBIP_10505 NLDBIP_10505 93.3 Morganella morganii S4 bltR2 GyrI-like small molecule binding domain
LHKJJB_10850 LHKJJB_10850 93.3 Morganella morganii S3 bltR2 GyrI-like small molecule binding domain
HKOGLL_13910 HKOGLL_13910 93.3 Morganella morganii S5 bltR2 GyrI-like small molecule binding domain

Distribution of the homologs in the orthogroup group_2824

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2824

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P96690 2.94e-32 123 30 5 276 4 ydfL Uncharacterized HTH-type transcriptional regulator YdfL Bacillus subtilis (strain 168)
P39075 9.44e-26 105 28 6 281 1 bmrR Multidrug-efflux transporter 1 regulator Bacillus subtilis (strain 168)
P39842 8.21e-20 89 41 3 120 4 bltR Multidrug-efflux transporter 2 regulator Bacillus subtilis (strain 168)
P0A4T9 2.35e-07 54 26 1 112 1 tipA HTH-type transcriptional activator TipA Streptomyces lividans
P0A4T8 2.35e-07 54 26 1 112 3 tipA HTH-type transcriptional activator TipA Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B8H172 1.09e-05 49 28 2 108 3 skgA HTH-type transcriptional regulator SkgA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAV4 1.09e-05 49 28 2 108 1 skgA HTH-type transcriptional regulator SkgA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9X5V4 1.25e-05 47 28 3 106 4 hmrR HTH-type transcriptional regulator HmrR Rhizobium leguminosarum bv. viciae
P58379 1.57e-05 47 29 3 107 3 hmrR2 Heavy metal-dependent transcription regulator 2 Rhizobium meliloti (strain 1021)
Q9X5X4 2.61e-05 46 29 3 107 1 hmrR HTH-type transcriptional regulator HmrR Sinorhizobium medicae (strain WSM419)
P22853 6.53e-05 45 32 2 111 1 merR1 Mercuric resistance operon regulatory protein Bacillus cereus
P0ACS5 6.84e-05 45 26 3 107 1 zntR HTH-type transcriptional regulator ZntR Escherichia coli (strain K12)
P0ACS6 6.84e-05 45 26 3 107 3 zntR HTH-type transcriptional regulator ZntR Escherichia coli O157:H7
P0C6D2 0.000225 43 30 3 106 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2W6 0.000225 43 30 3 106 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9HV30 0.000383 43 27 2 106 3 PA4778 Uncharacterized HTH-type transcriptional regulator PA4778 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O07586 0.000592 42 35 1 73 4 cueR HTH-type transcriptional regulator CueR Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS10720
Feature type CDS
Gene -
Product MerR family transcriptional regulator
Location 273644 - 274501 (strand: 1)
Length 858 (nucleotides) / 285 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2824
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF13411 MerR HTH family regulatory protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0789 Transcription (K) K DNA-binding transcriptional regulator, MerR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19575 MerR family transcriptional regulator, activator of bmr gene - -

Protein Sequence

MAKYFSIGEMAKLHKISIQTLRYYDQLGLFRPVYVDQESNYRYYTIDQFSQLDIIKYLKYLGMPLKEIKHRLQDPDTQILNLLTRKITVVDEKIRELELIKKVLSTKKETLEKGIDTDSIGKVTRRYIPRRHILSMDYEPGLSFEETMEFSRRQIANILEENISIFYGGVSGLVSRDNYLATQQVNYLNSFVIVERDLFNPQVQNKITEIPDGEFICLMYQGPYSDNGAAFKTITDYAEYKRIPVDDMMYEIPVIDPLSTNDKHQLLTEIQIKVKRREIDTRCLV

Flanking regions ( +/- flanking 50bp)

TTATCGTGCCGCCGGTTAATCATTAAGATGTGACTCAGAGGCGGCACGGTATGGCGAAATATTTTTCTATCGGCGAAATGGCAAAACTTCATAAAATCAGCATTCAAACGCTGCGTTATTATGATCAACTGGGGTTATTCAGACCGGTCTATGTCGATCAGGAAAGCAACTACCGCTATTACACTATCGATCAATTCTCTCAGCTGGATATTATTAAGTATCTGAAATACTTAGGGATGCCGCTGAAAGAGATCAAACACCGCTTACAGGACCCGGATACTCAAATCCTGAATCTGCTGACGCGGAAAATCACCGTTGTGGATGAAAAAATCCGTGAGCTGGAGCTGATTAAAAAAGTACTCTCCACCAAAAAAGAGACCCTGGAGAAGGGCATTGATACCGACAGCATCGGCAAAGTCACCCGCCGTTATATTCCCCGCCGCCATATTTTATCAATGGATTACGAACCGGGTCTGAGCTTTGAGGAAACGATGGAATTCTCACGGCGGCAGATTGCCAATATCCTGGAAGAGAATATTTCTATTTTCTACGGCGGTGTCAGCGGGCTGGTTTCCCGCGACAATTATCTTGCCACACAGCAGGTTAACTATCTGAACAGCTTTGTTATTGTTGAGCGTGACCTGTTTAATCCGCAGGTGCAGAATAAAATCACGGAAATCCCGGACGGGGAATTTATCTGTCTGATGTATCAGGGACCGTACAGTGACAATGGTGCGGCATTTAAAACCATCACCGATTATGCCGAATACAAACGTATTCCGGTGGATGATATGATGTATGAAATCCCGGTAATTGACCCGCTCTCAACCAATGATAAGCATCAGTTACTGACTGAAATCCAGATCAAAGTGAAACGGCGTGAAATAGATACGCGCTGCCTGGTGTAAAACTCTATTCCCGGTATAGATAACATGCAGAAACAGGCTGAAAACACAGA