Homologs in group_1427

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08820 FBDBKF_08820 94.1 Morganella morganii S1 rraB ribonuclease E inhibitor RraB
EHELCC_12705 EHELCC_12705 94.1 Morganella morganii S2 rraB ribonuclease E inhibitor RraB
NLDBIP_13045 NLDBIP_13045 94.1 Morganella morganii S4 rraB ribonuclease E inhibitor RraB
LHKJJB_13510 LHKJJB_13510 94.1 Morganella morganii S3 rraB ribonuclease E inhibitor RraB
HKOGLL_11520 HKOGLL_11520 94.1 Morganella morganii S5 rraB ribonuclease E inhibitor RraB
PMI_RS17235 PMI_RS17235 66.7 Proteus mirabilis HI4320 rraB ribonuclease E inhibitor RraB

Distribution of the homologs in the orthogroup group_1427

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1427

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AF92 6.19e-59 182 78 0 114 3 rraB Regulator of ribonuclease activity B Shigella flexneri
P0AF90 6.19e-59 182 78 0 114 1 rraB Regulator of ribonuclease activity B Escherichia coli (strain K12)
P0AF91 6.19e-59 182 78 0 114 3 rraB Regulator of ribonuclease activity B Escherichia coli O157:H7
D4GIR2 3.18e-57 177 68 1 135 3 rraB Regulator of ribonuclease activity B Pantoea ananatis (strain LMG 20103)
D3VIS7 1.57e-55 173 73 0 114 3 rraB Regulator of ribonuclease activity B Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
Q2NR38 1.15e-53 169 72 0 111 3 rraB Regulator of ribonuclease activity B Sodalis glossinidius (strain morsitans)
P0A1U6 3.26e-52 165 75 1 123 3 rraB Regulator of ribonuclease activity B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1U7 3.26e-52 165 75 1 123 3 rraB Regulator of ribonuclease activity B Salmonella typhi
C9XUB3 1.99e-47 153 69 2 119 3 rraB Regulator of ribonuclease activity B Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
B4F2M5 3.61e-44 145 71 0 114 3 rraB Regulator of ribonuclease activity B Proteus mirabilis (strain HI4320)
A1SAD4 6.68e-44 144 61 0 113 3 rraB Regulator of ribonuclease activity B Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8FQV9 2.76e-41 137 55 0 118 3 rraB Regulator of ribonuclease activity B Shewanella sediminis (strain HAW-EB3)
A6VKX6 1.99e-40 135 60 1 120 3 rraB Regulator of ribonuclease activity B Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A0KNU5 1.4e-38 129 54 0 110 3 rraB Regulator of ribonuclease activity B Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q12RV3 1.87e-37 127 56 0 109 3 rraB Regulator of ribonuclease activity B Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
P44831 3.23e-37 127 56 0 114 1 rraB Regulator of ribonuclease activity B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B5F9Q2 7.52e-37 126 58 1 126 3 rraB Regulator of ribonuclease activity B Aliivibrio fischeri (strain MJ11)
A4SJC2 6.26e-36 123 52 0 110 3 rraB Regulator of ribonuclease activity B Aeromonas salmonicida (strain A449)
A1ST89 3.88e-34 119 52 0 115 3 rraB Regulator of ribonuclease activity B Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B4RWP8 1.16e-33 117 54 1 111 3 rraB Regulator of ribonuclease activity B Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q7VNY1 7.23e-31 111 51 0 115 3 rraB Regulator of ribonuclease activity B Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q3IG75 9.71e-30 107 50 0 111 3 rraB Regulator of ribonuclease activity B Pseudoalteromonas translucida (strain TAC 125)
Q6LUW5 2.62e-29 107 54 2 121 3 rraB Regulator of ribonuclease activity B Photobacterium profundum (strain SS9)
Q15X31 1.36e-26 99 45 0 107 3 rraB Regulator of ribonuclease activity B Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q487J9 4.13e-24 93 46 0 111 3 rraB Regulator of ribonuclease activity B Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q5QY14 1.14e-18 79 41 1 107 3 rraB Regulator of ribonuclease activity B Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS10040
Feature type CDS
Gene rraB
Product ribonuclease E inhibitor RraB
Location 114422 - 114871 (strand: 1)
Length 450 (nucleotides) / 149 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1427
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06877 Regulator of ribonuclease activity B

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3076 Translation, ribosomal structure and biogenesis (J) J Regulator of RNase E activity RraB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09893 regulator of ribonuclease activity B - -

Protein Sequence

MAMSELDAFLEEQREETRAIITELLEDGSDPDAQYTVEHHFSSEDYDKLEKAAVEAFKLGYEVTDAEELEVEGGQVVLCCDIISECGLKAEHIDAQVEQLARLAEKMDVDYDGWGTYFEDPDGEDEDGEEDDEGDDEGDDESHGETPLH

Flanking regions ( +/- flanking 50bp)

TCAATGACGCCCGCTGTGGGAAAATGCGCGGGTATCACTTATCAGAGGGCATGGCCATGTCAGAATTAGATGCGTTTTTAGAAGAACAGCGTGAAGAAACCCGCGCAATTATTACTGAGTTATTAGAGGACGGCAGCGATCCTGATGCGCAGTATACTGTTGAGCACCATTTTTCGAGCGAAGATTACGACAAATTAGAAAAAGCAGCAGTTGAAGCCTTTAAACTGGGCTATGAAGTGACTGATGCTGAAGAGCTGGAAGTGGAAGGCGGCCAGGTTGTATTATGCTGCGACATTATCAGTGAGTGCGGCCTGAAAGCAGAACATATTGATGCTCAGGTTGAGCAGCTCGCCCGTCTGGCTGAAAAGATGGACGTGGATTACGACGGCTGGGGCACGTATTTCGAAGATCCTGATGGTGAAGACGAAGACGGTGAAGAAGATGACGAAGGTGATGATGAAGGCGATGACGAAAGTCACGGCGAAACACCATTACATTGATTATCCGTTCCCCTGAAAAACCTGCCGTGGCAGGTTTTTTTGTTTTTTAC