Homologs in group_1484

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08820 FBDBKF_08820 69.4 Morganella morganii S1 rraB ribonuclease E inhibitor RraB
EHELCC_12705 EHELCC_12705 69.4 Morganella morganii S2 rraB ribonuclease E inhibitor RraB
NLDBIP_13045 NLDBIP_13045 69.4 Morganella morganii S4 rraB ribonuclease E inhibitor RraB
LHKJJB_13510 LHKJJB_13510 69.4 Morganella morganii S3 rraB ribonuclease E inhibitor RraB
HKOGLL_11520 HKOGLL_11520 69.4 Morganella morganii S5 rraB ribonuclease E inhibitor RraB
F4V73_RS10040 F4V73_RS10040 66.7 Morganella psychrotolerans rraB ribonuclease E inhibitor RraB

Distribution of the homologs in the orthogroup group_1484

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1484

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F2M5 2.34e-99 284 100 0 143 3 rraB Regulator of ribonuclease activity B Proteus mirabilis (strain HI4320)
D4GIR2 2.75e-60 185 73 0 126 3 rraB Regulator of ribonuclease activity B Pantoea ananatis (strain LMG 20103)
P0AF92 8.5e-60 184 74 0 120 3 rraB Regulator of ribonuclease activity B Shigella flexneri
P0AF90 8.5e-60 184 74 0 120 1 rraB Regulator of ribonuclease activity B Escherichia coli (strain K12)
P0AF91 8.5e-60 184 74 0 120 3 rraB Regulator of ribonuclease activity B Escherichia coli O157:H7
D3VIS7 2.19e-52 165 70 0 120 3 rraB Regulator of ribonuclease activity B Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
P0A1U6 4.06e-52 164 76 0 120 3 rraB Regulator of ribonuclease activity B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1U7 4.06e-52 164 76 0 120 3 rraB Regulator of ribonuclease activity B Salmonella typhi
Q2NR38 9.91e-51 161 72 0 109 3 rraB Regulator of ribonuclease activity B Sodalis glossinidius (strain morsitans)
C9XUB3 8.35e-50 159 73 1 116 3 rraB Regulator of ribonuclease activity B Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
A1SAD4 5.36e-43 141 57 0 115 3 rraB Regulator of ribonuclease activity B Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A6VKX6 4.36e-41 137 59 1 121 3 rraB Regulator of ribonuclease activity B Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P44831 2.76e-39 132 57 0 115 1 rraB Regulator of ribonuclease activity B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B5F9Q2 2.88e-39 132 63 0 114 3 rraB Regulator of ribonuclease activity B Aliivibrio fischeri (strain MJ11)
A0KNU5 1.17e-37 127 52 0 113 3 rraB Regulator of ribonuclease activity B Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q12RV3 1.89e-37 127 53 0 115 3 rraB Regulator of ribonuclease activity B Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1ST89 4.07e-37 126 55 0 111 3 rraB Regulator of ribonuclease activity B Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A4SJC2 2.27e-36 124 51 0 113 3 rraB Regulator of ribonuclease activity B Aeromonas salmonicida (strain A449)
A8FQV9 5.75e-35 121 48 0 120 3 rraB Regulator of ribonuclease activity B Shewanella sediminis (strain HAW-EB3)
B4RWP8 3.37e-31 111 53 0 98 3 rraB Regulator of ribonuclease activity B Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q6LUW5 3.34e-30 108 56 1 118 3 rraB Regulator of ribonuclease activity B Photobacterium profundum (strain SS9)
Q7VNY1 3.52e-30 109 52 0 118 3 rraB Regulator of ribonuclease activity B Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q3IG75 6.92e-30 107 51 0 106 3 rraB Regulator of ribonuclease activity B Pseudoalteromonas translucida (strain TAC 125)
Q15X31 9.8e-28 102 44 0 112 3 rraB Regulator of ribonuclease activity B Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q487J9 3.81e-23 90 45 0 111 3 rraB Regulator of ribonuclease activity B Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q5QY14 6.88e-21 85 40 1 111 3 rraB Regulator of ribonuclease activity B Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17235
Feature type CDS
Gene rraB
Product ribonuclease E inhibitor RraB
Location 3784460 - 3784891 (strand: 1)
Length 432 (nucleotides) / 143 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1484
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06877 Regulator of ribonuclease activity B

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3076 Translation, ribosomal structure and biogenesis (J) J Regulator of RNase E activity RraB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09893 regulator of ribonuclease activity B - -

Protein Sequence

MADSKELAEQREETRLIIEELLEDGSDPDALYAIEHHISCENFETLEKAAVEVFKLGYEVTEPEEIEIESGEILVCFDAVSESGLNAELIDAQVEQLMNLAEKMGVYYDGWGTYFEDPDAEYDDEDGENEDDESESDKSSRLH

Flanking regions ( +/- flanking 50bp)

CCTGTGGGAGAATAACCAAGATATCTTTCAGACTATTGCGGAGCGGAATTATGGCGGACAGCAAAGAGCTAGCAGAACAACGTGAAGAAACACGTCTTATTATTGAAGAATTACTCGAAGATGGCAGTGATCCCGATGCACTGTACGCAATTGAACACCACATTTCATGTGAAAATTTTGAAACGTTAGAAAAAGCGGCTGTTGAAGTTTTTAAATTAGGTTATGAAGTCACCGAGCCTGAAGAAATTGAAATTGAATCAGGTGAGATCTTAGTCTGCTTTGATGCGGTTAGTGAAAGTGGTCTAAATGCTGAACTGATTGATGCGCAAGTAGAACAGTTAATGAATTTAGCGGAAAAAATGGGTGTCTATTACGACGGCTGGGGAACTTATTTTGAAGATCCCGACGCTGAGTACGATGACGAAGATGGCGAAAATGAAGATGACGAAAGCGAGTCTGATAAGTCATCACGCCTGCACTAATTGGCGCTATATGTTGTCCCAATGTACCAGTCTTTAGGTGCAAAAAAGAA