Homologs in group_1390

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08590 FBDBKF_08590 94.7 Morganella morganii S1 ispB octaprenyl diphosphate synthase
EHELCC_12935 EHELCC_12935 94.7 Morganella morganii S2 ispB octaprenyl diphosphate synthase
NLDBIP_13275 NLDBIP_13275 94.7 Morganella morganii S4 ispB octaprenyl diphosphate synthase
LHKJJB_13280 LHKJJB_13280 94.7 Morganella morganii S3 ispB octaprenyl diphosphate synthase
HKOGLL_11750 HKOGLL_11750 94.7 Morganella morganii S5 ispB octaprenyl diphosphate synthase
PMI_RS16945 PMI_RS16945 83.0 Proteus mirabilis HI4320 ispB octaprenyl diphosphate synthase

Distribution of the homologs in the orthogroup group_1390

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1390

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AD58 0.0 505 74 0 321 3 ispB Octaprenyl diphosphate synthase Shigella flexneri
P0AD57 0.0 505 74 0 321 1 ispB Octaprenyl diphosphate synthase Escherichia coli (strain K12)
P44916 1.56e-149 426 63 0 322 1 ispB Octaprenyl diphosphate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O24743 8.05e-98 294 47 3 320 1 sdsA All-trans-nonaprenyl-diphosphate synthase (geranyl-diphosphate specific) Rhodobacter capsulatus
Q0INZ4 3.19e-53 182 31 3 322 3 SPS3 Probable solanesyl-diphosphate synthase 3, chloroplastic Oryza sativa subsp. japonica
Q76FS5 6.64e-52 179 31 2 324 1 SPS2 Solanesyl diphosphate synthase 2, chloroplastic Arabidopsis thaliana
Q75HZ9 2.52e-51 177 30 3 322 1 SPS2 Solanesyl-diphosphate synthase 2, chloroplastic Oryza sativa subsp. japonica
Q8S948 4.75e-50 174 32 2 312 1 SPS1 Solanesyl diphosphate synthase 1, chloroplastic Arabidopsis thaliana
P31114 4.33e-49 170 30 1 311 1 hepT Heptaprenyl diphosphate synthase component 2 Bacillus subtilis (strain 168)
P55785 8.16e-48 166 30 1 315 3 hepT Heptaprenyl diphosphate synthase component 2 Geobacillus stearothermophilus
O43091 9.11e-48 167 32 6 345 1 dps1 Decaprenyl-diphosphate synthase subunit 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P72580 1.7e-47 165 31 3 324 3 preA Prenyl transferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9TLS1 2.27e-47 165 30 3 315 3 preA Prenyl transferase Cyanidium caldarium
Q1XDL8 1.36e-46 163 32 3 289 3 preA Prenyl transferase Neopyropia yezoensis
Q653T6 2.93e-46 165 33 4 317 1 SPS1 Solanesyl-diphosphate synthase 1, mitochondrial Oryza sativa subsp. japonica
Q53479 3.67e-46 162 34 3 288 1 idsA Short chain isoprenyl diphosphate synthase Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
P39464 8.1e-46 161 31 6 320 1 gds Geranylgeranyl diphosphate synthase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
P51268 8.8e-46 160 31 2 287 3 preA Prenyl transferase Porphyra purpurea
A0A0A7GEY4 1.06e-45 160 31 5 325 1 GACE_1337 Geranylgeranyl pyrophosphate synthase Geoglobus acetivorans
O26156 2.14e-44 157 33 3 288 3 idsA Short chain isoprenyl diphosphate synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P31171 3.03e-43 154 31 2 319 3 preA Prenyl transferase Cyanophora paradoxa
Q7S565 1.59e-42 155 32 7 370 3 NCU02305 Probable hexaprenyl pyrophosphate synthase, mitochondrial Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q5T2R2 1.77e-42 154 32 7 322 1 PDSS1 All trans-polyprenyl-diphosphate synthase PDSS1 Homo sapiens
Q5HZ00 2.52e-41 151 31 7 343 1 SPS3 Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial Arabidopsis thaliana
Q54VJ9 4.67e-41 151 31 4 334 3 coq1 Decaprenyl-diphosphate synthase Dictyostelium discoideum
P95999 6.24e-41 148 27 3 314 3 gds Geranylgeranyl diphosphate synthase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q8PW34 1.04e-40 147 33 4 292 3 MM_1767 Geranylgeranyl diphosphate synthase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
O66129 6e-40 145 28 2 308 1 hexs-b Hexaprenyl-diphosphate synthase large subunit ((2E,6E)-farnesyl-diphosphate specific) Micrococcus luteus
Q33DR2 2.21e-39 146 34 5 255 1 Pdss1 All trans-polyprenyl-diphosphate synthase PDSS1 Mus musculus
Q58270 1.13e-38 142 34 3 233 3 idsA Short chain isoprenyl diphosphate synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q6CBH3 1.66e-38 144 35 4 264 3 COQ1 Probable hexaprenyl pyrophosphate synthase, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
P18900 1.69e-34 134 32 5 303 1 COQ1 Hexaprenyl pyrophosphate synthase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B1XJV9 8.53e-34 129 31 7 256 1 crtE Geranylgeranyl pyrophosphate synthase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q08291 4.29e-33 127 34 5 225 1 None Farnesyl diphosphate synthase Geobacillus stearothermophilus
Q9UWR6 2.54e-31 122 32 3 276 1 fgs Geranylfarnesyl diphosphate synthase Aeropyrum pernix
O06428 3.39e-31 122 32 6 289 1 grcC1 Nonaprenyl diphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q94ID7 5.32e-31 123 32 6 261 1 GGPS Geranylgeranyl pyrophosphate synthase, chloroplastic Hevea brasiliensis
Q3IPL1 7.98e-31 122 29 5 328 1 idsA3 Geranylfarnesyl diphosphate synthase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q42698 1.15e-30 122 33 6 235 3 GGPS1 Geranylgeranyl pyrophosphate synthase, chloroplastic Catharanthus roseus
Q9ZU77 1.52e-29 118 31 6 263 2 At2g18620 Geranylgeranyl pyrophosphate synthase 7, chloroplastic Arabidopsis thaliana
Q8PYS1 6.83e-29 115 30 5 239 1 MM_0789 Geranylfarnesyl diphosphate synthase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
O05572 1.67e-28 115 29 9 321 1 grcC2 Dimethylallyltranstransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P80042 2.82e-28 115 30 3 245 1 GGPS1 Geranylgeranyl pyrophosphate synthase, chloroplastic Capsicum annuum
Q9LRR0 3.21e-28 115 34 5 238 5 At3g14510 Putative geranylgeranyl pyrophosphate synthase 8, chloroplastic Arabidopsis thaliana
Q9SLG2 6.33e-28 114 29 6 269 1 GGPP4 Geranylgeranyl pyrophosphate synthase 4 Arabidopsis thaliana
P34802 8.12e-28 114 29 6 263 1 GGPPS1 Heterodimeric geranylgeranyl pyrophosphate synthase large subunit 1, chloroplastic Arabidopsis thaliana
P48368 5.66e-27 110 30 3 235 3 crtE Geranylgeranyl diphosphate synthase Cyanophora paradoxa
P9WKH1 5.81e-27 112 28 4 300 1 Rv3398c (2E,6E)-farnesyl diphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKH0 5.81e-27 112 28 4 300 3 MT3506 (2E,6E)-farnesyl diphosphate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5H9 5.81e-27 112 28 4 300 3 BQ2027_MB3431C (2E,6E)-farnesyl diphosphate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q43133 2.22e-26 110 29 6 245 1 GGPS1 Geranylgeranyl pyrophosphate synthase, chloroplastic/chromoplastic Sinapis alba
A0A0U3BRC5 2.92e-26 110 30 6 266 1 GFDPS Geranylfarnesyl diphosphate synthase, chloroplastic Leucosceptrum canum
P54383 4.96e-26 108 32 6 234 3 ispA Farnesyl diphosphate synthase Bacillus subtilis (strain 168)
O50410 4.27e-25 106 29 5 269 1 idsB Geranylgeranyl diphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O04046 1.09e-24 105 28 6 240 1 GGPPS2 Heterodimeric geranylgeranyl pyrophosphate synthase large subunit 2 Arabidopsis thaliana
V5TF61 2.39e-24 104 30 5 239 1 ambP2 Dimethylallyltranstransferase Fischerella ambigua (strain UTEX 1903)
O66126 4.14e-24 102 29 4 243 3 fps Farnesyl diphosphate synthase Micrococcus luteus
Q9LUD9 5.1e-24 103 32 5 238 1 GGPP3 Geranylgeranyl pyrophosphate synthase 3, chloroplastic Arabidopsis thaliana
Q9LUE1 1.36e-23 102 34 7 239 1 GGPPS9 Geranylgeranyl pyrophosphate synthase 9, chloroplastic Arabidopsis thaliana
Q9LIA0 1.53e-23 102 32 6 259 2 At3g29430 Geranylgeranyl pyrophosphate synthase 11, chloroplastic Arabidopsis thaliana
Q9LHR4 2.66e-23 101 34 5 238 2 At3g32040 Geranylgeranyl pyrophosphate synthase 12, chloroplastic Arabidopsis thaliana
O22043 4.96e-23 100 33 7 246 1 GGPP6 Geranylgeranyl pyrophosphate synthase 6, mitochondrial Arabidopsis thaliana
P21684 1.02e-22 99 33 7 207 3 crtE Geranylgeranyl diphosphate synthase Pantoea ananas
O66952 1.14e-22 98 30 7 233 3 ispA Farnesyl diphosphate synthase Aquifex aeolicus (strain VF5)
Q9LJY2 2.48e-22 99 32 5 217 1 At3g20160 Geranylgeranyl pyrophosphate synthase 10, mitochondrial Arabidopsis thaliana
A0A0E3D8P4 1.29e-21 96 26 5 271 3 penG Geranylgeranyl pyrophosphate synthase penG Penicillium crustosum
A0A140JWS2 3.89e-21 95 26 5 271 3 ptmG Geranylgeranyl pyrophosphate synthase penG Penicillium simplicissimum
A0A1Y1C7Q5 5.7e-21 97 26 4 269 3 EvQS Quiannulatene synthase Emericella variicolor
P17060 7.15e-21 94 32 7 211 3 crtE Geranylgeranyl diphosphate synthase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
A0A1B4XBK0 1.61e-20 95 29 7 267 3 sdnC Geranylgeranyl diphosphate synthase sdnC Sordaria araneosa
Q6F5E6 4.48e-20 92 24 4 257 1 GGS Geranylgeranyl pyrophosphate synthase Neocamarosporium betae
P22939 4.81e-20 91 31 6 235 1 ispA Farnesyl diphosphate synthase Escherichia coli (strain K12)
Q92236 3.81e-19 90 25 4 249 3 GGS Geranylgeranyl pyrophosphate synthase Gibberella fujikuroi
P9WEW8 6.09e-19 89 25 6 265 1 dpmpD Geranylgeranyl pyrophosphate synthase dpmpD Macrophomina phaseolina (strain MS6)
P45204 2.06e-18 87 28 7 263 3 ispA Farnesyl diphosphate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P9WEQ2 2.98e-18 87 23 5 298 3 olcC Geranylgeranyl pyrophosphate synthase olcC Penicillium canescens
K2SUY0 3.42e-18 88 27 5 225 1 MPH_02178 Macrophomene synthase Macrophomina phaseolina (strain MS6)
A0A0E3D8M9 4.64e-18 87 27 4 223 3 janG Geranylgeranyl pyrophosphate synthase janG Penicillium janthinellum
F9WZD2 6.95e-18 86 26 4 257 3 GGS1 Geranylgeranyl pyrophosphate synthase 1 Zymoseptoria tritici (strain CBS 115943 / IPO323)
O53507 7.44e-18 86 28 12 329 1 idsA2 (2E,6E)-farnesyl diphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
F9WWF1 9.06e-18 85 25 5 220 3 GGS2 Geranylgeranyl pyrophosphate synthase 2 Zymoseptoria tritici (strain CBS 115943 / IPO323)
A0A1L9UKS1 9.14e-18 87 29 5 222 1 AbVS Variediene synthase Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946)
P54976 1.14e-17 85 32 8 209 3 crtE Geranylgeranyl diphosphate synthase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P22873 1.41e-17 85 31 8 206 1 crtE Geranylgeranyl diphosphate synthase Pseudescherichia vulneris
F9XLC1 1.67e-17 85 26 3 217 3 GGS3 Geranylgeranyl pyrophosphate synthase 3 Zymoseptoria tritici (strain CBS 115943 / IPO323)
C9K2Q3 2.27e-17 86 30 2 210 1 bsc8 Fusicoccadiene synthase Alternaria brassicicola
Q9P885 7.04e-17 82 22 4 274 1 carG Geranylgeranyl pyrophosphate synthase Mucor circinelloides f. lusitanicus
A0A0P0ZEM1 9.14e-17 84 27 6 224 1 Stl-SS Stellatatriene synthase Emericella variicolor
P9WEX3 9.89e-17 82 25 3 235 1 dpasD Geranylgeranyl pyrophosphate synthase dpasD Apiospora sacchari
P9WER5 1.66e-16 83 27 8 272 1 None Talaropentaene synthase Talaromyces verruculosus
A0A1L9WQI2 3.03e-16 82 28 6 224 1 vrcA Bifunctional sesterterpene synthase Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
A0A348FUE1 3.56e-16 82 25 4 250 1 PvCPS Copalyl diphosphate synthase Talaromyces verruculosus
A0A1U8QLG8 3.81e-16 82 26 7 279 2 AN1592 Geranylgeranyl pyrophosphate synthase AN1592 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q39108 3.83e-16 81 25 8 217 1 GGR Heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic Arabidopsis thaliana
I1RL14 4.26e-16 81 26 4 211 1 dpfgD Geranylgeranyl pyrophosphate synthase dpfgD Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
B2DBE9 6.11e-16 81 25 6 256 1 GGS-D Geranylgeranyl pyrophosphate synthase D Phomopsis amygdali
N4V6D4 8.78e-16 81 25 4 231 1 btcA Sesterterpene synthase btcA Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)
P55539 9.38e-16 80 32 6 183 3 NGR_a02750 Probable farnesyl diphosphate synthase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q54BK1 9.41e-16 79 24 7 285 3 ggps1 Geranylgeranyl pyrophosphate synthase Dictyostelium discoideum
A0A2Z6AQX6 1.25e-15 81 26 8 239 1 PvPS Preasperterpenoid A synthase PvPS Talaromyces verruculosus
O95749 1.25e-15 79 25 6 283 1 GGPS1 Geranylgeranyl pyrophosphate synthase Homo sapiens
Q12051 1.78e-15 79 24 4 223 1 BTS1 Geranylgeranyl pyrophosphate synthase BTS1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q758K0 2.51e-15 79 26 8 293 3 BTS1 Geranylgeranyl pyrophosphate synthase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
P56966 3.24e-15 78 25 6 282 1 GGPS1 Geranylgeranyl pyrophosphate synthase Bos taurus
A2PZA5 3.45e-15 79 27 7 255 1 PaFS Fusicoccadiene synthase Phomopsis amygdali
Q672V6 3.7e-15 78 23 5 275 2 atmG Geranylgeranyl pyrophosphate synthase atmG Aspergillus flavus
P9WEP0 4.13e-15 79 26 6 257 1 AuAS Aspergildiene synthase Aspergillus ustus
A0A7D0AGU9 4.18e-15 77 23 4 266 2 TPS Terpene synthase Matsumurasca onukii
A0A0P0ZD79 4.31e-15 79 28 6 224 1 EvVS Variediene synthase Emericella variicolor
Q45220 9.45e-15 77 30 6 214 3 fppS Probable farnesyl diphosphate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A0A8K1AY78 1.29e-14 78 25 5 224 1 tndC Bifunctional type I diterpene synthase tndC Aspergillus flavipes
Q56RZ7 1.65e-14 76 25 7 272 2 ltmG Geranylgeranyl pyrophosphate synthase ltmG Epichloe festucae var. lolii
Q56RZ3 1.65e-14 76 25 7 272 2 ltmG Geranylgeranyl pyrophosphate synthase ltmG Epichloe festucae (strain Fl1)
P24322 1.74e-14 77 24 6 270 2 al-3 Geranylgeranyl pyrophosphate synthase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P9WEX9 2.6e-14 75 25 3 210 1 dpmaD Geranylgeranyl pyrophosphate synthase dpmaD Metarhizium anisopliae
M2V8C1 3.06e-14 77 26 7 276 1 oblA Ophiobolin F synthase oblA Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O)
A0A858E7G0 3.31e-14 75 26 11 302 1 GGDPS Geranylgeranyl pyrophosphate synthase Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7)
Q9WTN0 3.34e-14 75 23 5 279 1 Ggps1 Geranylgeranyl pyrophosphate synthase Mus musculus
H1VQB1 4.11e-14 75 25 4 211 1 dpchD Geranylgeranyl pyrophosphate synthase dpchD Colletotrichum higginsianum (strain IMI 349063)
J7FIX8 4.54e-14 75 26 5 215 3 idtG Geranylgeranyl pyrophosphate synthase idtG Claviceps paspali
A0A1V1FVQ6 4.82e-14 76 26 6 248 1 oblA Ophiobolin F synthase oblA Emericella variicolor
S0E627 5.62e-14 75 26 5 257 2 GGS2 Geranylgeranyl pyrophosphate synthase 2 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
W6QAE7 6.4e-14 75 27 4 184 1 PrDS Conidiogenone synthase Penicillium roqueforti (strain FM164)
A0A0U5G0B1 6.45e-14 75 25 5 233 1 AcldOS Ophiobolin F synthase Aspergillus calidoustus
B6HFX8 8.37e-14 75 27 5 194 1 PchDS Conidiogenone synthase Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
Q6F596 1.12e-13 73 24 4 265 2 Ggps1 Geranylgeranyl pyrophosphate synthase Rattus norvegicus
P9WEV7 1.49e-13 74 30 4 179 1 CgDS Dolasta-1(15),8-diene synthase Colletotrichum gloeosporioides
E9F5E9 2.17e-13 73 23 4 219 1 subD Geranylgeranyl pyrophosphate synthase subD Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
B2DBE8 3.07e-13 73 26 3 215 1 GGS-A Geranylgeranyl pyrophosphate synthase A Phomopsis amygdali
P9WEV6 3.36e-13 73 28 6 265 1 PaPS Phomopsene synthase Phomopsis amygdali
A1C8C3 4.56e-13 73 24 6 232 1 oblA Ophiobolin F synthase oblA Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
A0A2I6PJ05 6.68e-13 72 24 5 252 3 ggs1 Geranylgeranyl pyrophosphate synthase Hypoxylon pulicicidum
A0A2Z6FZ31 6.98e-13 72 25 4 185 1 btcA Sesterterpene synthase btcA Neocamarosporium betae
A0A858E6N7 1.17e-12 71 26 6 219 1 GGDPS Geranylgeranyl pyrophosphate synthase Melampsora lini
P9WER6 1.26e-12 72 26 8 250 1 None Fusoxypene synthase Fusarium oxysporum
A0A2Z6AQX7 1.34e-12 72 26 5 219 1 PbSS Sesterbrasiliatriene synthase PbSS Penicillium brasilianum
Q9C446 1.38e-12 71 24 4 252 3 paxG Geranylgeranyl pyrophosphate synthase paxG Penicillium paxilli
Q8K9A0 1.92e-12 70 26 9 261 3 ispA Farnesyl diphosphate synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A0A2L0VXR5 4.56e-12 69 25 5 270 2 GGPS Geranylgeranyl pyrophosphate synthase Clitopilus passeckerianus
M2U578 6.05e-12 70 27 4 181 1 tpcA Preterpestacin I synthase tpcA Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O)
A0A1L7VFX3 6.27e-12 70 28 6 187 1 FUP1 Bifunctional terpene synthase FUP1 Fusarium proliferatum (strain ET1)
A0A8H4CUY8 8.65e-12 69 24 5 225 1 GCG54_00000376 Colleterpenol synthase Colletotrichum gloeosporioides
A0A169T193 1.1e-11 69 24 4 253 1 EvAS Astellifadiene synthase Emericella variicolor
A0A6S6QJ62 1.32e-11 68 26 6 273 1 ple4 Geranylgeranyl pyrophosphate synthase Rhodocybe pseudopiperita
P57537 1.43e-11 67 25 12 285 3 ispA Farnesyl diphosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A0A8D5M3Y5 4.03e-11 67 25 6 210 1 esdpD Geranylgeranyl pyrophosphate synthase esdpD Penicillium shearii
A0A3Q9FFM1 7.92e-11 66 26 5 182 1 astC Bifunctional sesterterpene synthase astC Talaromyces wortmannii
P9WEV2 6.84e-10 63 22 4 223 1 sttA Preaspterpenacid I synthase sttA Aspergillus terreus
A0A348DU52 1.09e-09 63 26 8 213 1 PcCS Cyclopiane-type diterpene synthase Penicillium chrysogenum
A0A858E7J4 1.18e-09 62 25 7 184 1 ILTPS1 IDS-like terpene synthase 1 Melampsora lini
A1DN30 1.34e-09 62 23 4 216 1 NfSS Sesterfisherol synthase Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q97W92 2.46e-09 60 29 9 218 1 gdS-2 Hexaprenyl pyrophosphate synthase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A0A3S5XFG0 2.72e-09 61 21 7 267 1 cle6 Geranylgeranyl pyrophosphate synthase cle6 Aspergillus versicolor
A0A858E899 4.73e-09 60 26 7 189 1 ILTPS3 IDS-like terpene synthase 3 Melampsora lini
A0A1V0QSA8 6.37e-09 60 21 7 277 2 eriE Geranylgeranyl pyrophosphate synthase AN1592 Hericium erinaceus
Q0CRW6 1.54e-08 59 22 5 223 1 sttA Preaspterpenacid I synthase sttA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A858E4Y6 1.59e-08 58 26 8 184 1 ILTPS2 IDS-like terpene synthase 2 Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7)
A0A858EAD5 5.99e-08 57 23 6 182 1 ILTPS2 IDS-like terpene synthase 2 Melampsora lini
A0A858E4Y8 6.39e-08 57 23 6 182 1 ILTPS1 IDS-like terpene synthase 1 Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7)
D7PHZ5 6.47e-08 57 25 7 233 1 vrtD Farnesyl pyrophosphate synthase vrtD Penicillium aethiopicum
Q5U2R1 2.63e-06 52 21 13 346 2 Pdss2 All trans-polyprenyl-diphosphate synthase PDSS2 Rattus norvegicus
P0C9E2 4.48e-06 51 27 7 195 3 Ken-086 Trans-prenyltransferase African swine fever virus (isolate Pig/Kenya/KEN-50/1950)
P08836 4.59e-06 51 25 9 254 1 FDPS Farnesyl pyrophosphate synthase Gallus gallus
Q09152 6.47e-06 50 25 5 202 2 FPS1 Farnesyl pyrophosphate synthase 1, mitochondrial Arabidopsis thaliana
Q8V9T7 1.19e-05 50 27 6 188 3 Mal-082 Trans-prenyltransferase African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983)
P0C9E0 1.53e-05 49 27 6 188 3 Pret-086 Trans-prenyltransferase African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996)
Q86YH6 1.63e-05 49 21 7 261 1 PDSS2 All trans-polyprenyl-diphosphate synthase PDSS2 Homo sapiens
B4YA15 1.77e-05 49 24 8 241 2 FPS Farnesyl pyrophosphate synthase Ganoderma lucidum
Q33DR3 1.89e-05 49 23 9 266 1 Pdss2 All trans-polyprenyl-diphosphate synthase PDSS2 Mus musculus
Q65164 2.41e-05 48 27 6 188 1 Ba71V-074 Trans-prenyltransferase African swine fever virus (strain Badajoz 1971 Vero-adapted)
Q9NH03 2.63e-05 48 25 8 209 2 fps Farnesyl diphosphate synthase Dictyostelium discoideum
P0C9E1 3.71e-05 48 26 6 188 3 War-084 Trans-prenyltransferase African swine fever virus (isolate Warthog/Namibia/Wart80/1980)
P05369 4.43e-05 48 24 8 254 2 Fdps Farnesyl pyrophosphate synthase Rattus norvegicus
Q920E5 4.89e-05 48 25 7 218 1 Fdps Farnesyl pyrophosphate synthase Mus musculus
P14324 5.83e-05 48 23 7 237 1 FDPS Farnesyl pyrophosphate synthase Homo sapiens
A0A7J6HWR9 6.73e-05 47 22 7 217 2 FPPS1 Farnesyl pyrophosphate synthase 1 Cannabis sativa
O14230 8.57e-05 47 24 6 203 1 fps1 Farnesyl pyrophosphate synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0A7J6FUX2 0.000184 46 22 5 172 2 GPPS.ssu2 Heterodimeric geranylgeranyl pyrophosphate synthase small subunit 2, chloroplastic Cannabis sativa
A0A343W970 0.000378 45 25 12 277 1 FPPS Farnesyl pyrophosphate synthase Murgantia histrionica
Q672V5 0.001 44 24 8 236 2 atmC Prenyl transferase atmC Aspergillus flavus
A0A1V0QSH7 0.001 44 26 9 231 2 FPPS2 Farnesyl pyrophosphate synthase 2 Cannabis sativa

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09815
Feature type CDS
Gene ispB
Product octaprenyl diphosphate synthase
Location 66914 - 67885 (strand: -1)
Length 972 (nucleotides) / 323 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1390
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00348 Polyprenyl synthetase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0142 Coenzyme transport and metabolism (H) H Geranylgeranyl pyrophosphate synthase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02523 octaprenyl-diphosphate synthase [EC:2.5.1.90] Terpenoid backbone biosynthesis
Biosynthesis of secondary metabolites		 -

Protein Sequence

MNSEQIIALTADDMTAVNQKIQKQLTSDVSLINQLGYYIISGGGKRIRPMIAVLTGRALGYTGDKHIQVAALIEFIHTATLLHDDVVDESDMRRGKQTANEVFGNAASVLVGDFIYTRSFQMMTDLDSMRVLKLMAEATNVIAEGEVLQLMNCNNPEISEADYMQVIYSKTARLFEAASQSAAILAGATPEQEIALQNYGRYLGTAFQLIDDVLDYDADNTTLGKNTGDDLDEGKPTLPLLHAMHNGTPEESALIRQAIEQGNGRHLLEAVLTTMKRCGSLTYTYNRAEEEADKAIAALSLLPDSPYKAALAGLAHIAVRRSA

Flanking regions ( +/- flanking 50bp)

AAACCATTACCTTTGATCGGGATGTCAAAAACAAGGTTAAAGCCAGTATCATGAACTCAGAACAAATAATCGCGCTGACTGCTGATGATATGACCGCAGTCAATCAAAAGATTCAAAAACAGTTAACCTCAGATGTATCACTTATTAACCAGCTGGGTTATTACATTATCAGCGGAGGAGGGAAAAGGATCCGCCCGATGATCGCTGTGCTGACCGGCAGGGCTCTGGGATACACAGGTGACAAACATATTCAGGTCGCCGCATTGATCGAGTTTATCCATACTGCAACACTGCTGCATGATGATGTGGTGGACGAATCAGATATGCGCCGTGGTAAACAGACTGCAAATGAAGTGTTCGGCAACGCCGCAAGTGTGCTGGTCGGTGATTTTATCTACACGCGATCGTTTCAGATGATGACGGATCTTGATTCCATGCGCGTCCTGAAGCTGATGGCAGAAGCCACGAACGTGATCGCGGAAGGTGAAGTACTGCAACTGATGAACTGTAATAATCCGGAGATAAGCGAAGCGGACTACATGCAGGTTATCTACAGTAAAACGGCCCGTTTGTTTGAAGCCGCTTCACAATCTGCCGCGATCCTGGCCGGTGCCACACCGGAACAGGAAATTGCCCTTCAGAATTACGGCCGTTATCTCGGTACCGCATTTCAGCTGATTGATGATGTGCTGGATTATGATGCAGATAATACGACACTCGGTAAAAATACCGGTGATGACCTGGATGAAGGTAAACCCACACTTCCGCTGCTTCATGCCATGCATAACGGCACACCGGAAGAGTCCGCACTTATCCGTCAGGCCATTGAACAGGGTAACGGGCGTCATCTGCTGGAGGCGGTTCTCACCACGATGAAACGCTGCGGCTCCCTGACATATACCTATAACCGGGCTGAAGAGGAAGCGGACAAAGCTATTGCCGCGTTATCCTTATTGCCGGATTCACCTTATAAAGCCGCACTGGCAGGCCTTGCACATATCGCAGTACGCCGCTCCGCCTGACCATAAGCAAACGGGATCCTTTTGAGGATCCCGTTTTACTATTCCGGCTT