Homologs in group_1414

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08415 FBDBKF_08415 86.2 Morganella morganii S1 rsgA small ribosomal subunit biogenesis GTPase RsgA
EHELCC_13110 EHELCC_13110 86.2 Morganella morganii S2 rsgA small ribosomal subunit biogenesis GTPase RsgA
NLDBIP_13450 NLDBIP_13450 86.2 Morganella morganii S4 rsgA small ribosomal subunit biogenesis GTPase RsgA
LHKJJB_13105 LHKJJB_13105 86.2 Morganella morganii S3 rsgA small ribosomal subunit biogenesis GTPase RsgA
HKOGLL_11925 HKOGLL_11925 86.2 Morganella morganii S5 rsgA small ribosomal subunit biogenesis GTPase RsgA
PMI_RS16690 PMI_RS16690 73.9 Proteus mirabilis HI4320 rsgA small ribosomal subunit biogenesis GTPase RsgA

Distribution of the homologs in the orthogroup group_1414

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1414

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JIQ7 0.0 547 77 1 344 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7MYS7 0.0 545 76 2 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JMP8 0.0 542 77 1 344 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FC3 0.0 542 77 1 344 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRP7 0.0 542 77 1 344 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Yersinia pestis (strain Pestoides F)
Q1CEE7 0.0 542 77 1 344 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYN9 0.0 542 77 1 344 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIX0 0.0 542 77 1 344 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Yersinia pestis
B2K1Z6 0.0 542 77 1 344 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0Z2 0.0 542 77 1 344 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMY8 0.0 542 77 1 344 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B4F1Z6 0.0 533 73 2 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Proteus mirabilis (strain HI4320)
Q83IK0 0.0 529 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Shigella flexneri
B2TY39 0.0 528 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I268 0.0 528 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli (strain SE11)
A8A7Q8 0.0 528 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli O9:H4 (strain HS)
B5Z2H0 0.0 528 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XDP1 0.0 528 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli O157:H7
B7LC22 0.0 528 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli (strain 55989 / EAEC)
A7ZV32 0.0 528 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli O139:H28 (strain E24377A / ETEC)
P39286 0.0 527 72 1 350 1 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli (strain K12)
B1IT42 0.0 527 72 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XDR5 0.0 527 72 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli (strain K12 / DH10B)
C5A1F5 0.0 527 72 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli (strain K12 / MC4100 / BW2952)
B1LQI4 0.0 527 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli (strain SMS-3-5 / SECEC)
B7NG98 0.0 526 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FAL3 0.0 526 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7M8S4 0.0 526 72 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli O8 (strain IAI1)
B7MSX6 0.0 526 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli O81 (strain ED1a)
B7NTM0 0.0 526 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MKW8 0.0 526 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPY1 0.0 526 73 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7LLU5 0.0 526 72 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8Z193 0.0 524 72 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Salmonella typhi
Q8ZKB0 0.0 522 72 1 350 1 rsgA Small ribosomal subunit biogenesis GTPase RsgA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9N420 0.0 522 72 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T2Q8 0.0 522 72 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Salmonella newport (strain SL254)
B4TF97 0.0 522 72 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Salmonella heidelberg (strain SL476)
B5F378 0.0 522 72 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Salmonella agona (strain SL483)
A8G8U1 0.0 521 74 3 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Serratia proteamaculans (strain 568)
B4TSE3 0.0 521 72 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Salmonella schwarzengrund (strain CVM19633)
B5R024 0.0 519 72 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Salmonella enteritidis PT4 (strain P125109)
B5FRL9 0.0 519 72 1 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Salmonella dublin (strain CT_02021853)
B5Y341 0.0 516 71 3 353 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Klebsiella pneumoniae (strain 342)
A6TH78 0.0 514 72 3 353 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q9EV05 7.62e-179 502 70 3 351 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Dickeya dadantii (strain 3937)
C6DFN0 3.47e-176 495 72 3 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D036 6.24e-175 492 72 3 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NW87 8.27e-172 484 69 4 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Sodalis glossinidius (strain morsitans)
B2VCV1 1.86e-170 481 69 4 352 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q87L00 8.15e-154 439 61 4 346 3 rsgA1 Small ribosomal subunit biogenesis GTPase RsgA 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MGZ6 3.21e-151 432 59 4 345 3 rsgA1 Small ribosomal subunit biogenesis GTPase RsgA 1 Vibrio vulnificus (strain YJ016)
Q8DCV7 3.21e-151 432 59 4 345 3 rsgA1 Small ribosomal subunit biogenesis GTPase RsgA 1 Vibrio vulnificus (strain CMCP6)
C4K3T8 1.53e-150 430 63 2 342 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
P45339 3.09e-149 427 56 3 348 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UBG2 8.09e-149 426 56 3 348 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Haemophilus influenzae (strain PittEE)
Q9KV18 1.69e-148 427 60 4 346 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q4QJM9 4.35e-148 424 56 3 348 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Haemophilus influenzae (strain 86-028NP)
A5UFF1 6.04e-148 424 56 3 348 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Haemophilus influenzae (strain PittGG)
Q8EJ79 2.67e-142 409 57 3 354 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7VMF1 3.78e-142 409 56 3 344 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BS35 9.85e-141 405 55 4 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZX2 9.85e-141 405 55 4 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MYK2 9.85e-141 405 55 4 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q9CMD1 1.02e-140 405 54 3 350 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pasteurella multocida (strain Pm70)
A6VN14 2.11e-139 402 53 4 351 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0UT89 3.49e-135 391 54 4 349 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Histophilus somni (strain 2336)
Q0I447 5.07e-134 388 53 4 349 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Histophilus somni (strain 129Pt)
Q65SE2 4.42e-132 384 52 4 349 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q2SBB3 3.48e-105 315 48 6 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Hahella chejuensis (strain KCTC 2396)
C3KDV4 1.1e-102 308 46 5 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas fluorescens (strain SBW25)
Q1I439 1.37e-102 308 46 5 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas entomophila (strain L48)
Q4ZYY9 2.51e-102 308 46 5 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas syringae pv. syringae (strain B728a)
Q3KIZ8 3.55e-102 307 46 5 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas fluorescens (strain Pf0-1)
Q87VI5 3.67e-102 307 46 4 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48P11 6.98e-102 306 46 5 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B1JAE3 1.28e-101 306 46 5 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas putida (strain W619)
Q4KJ82 2.66e-101 305 47 5 345 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q88DC4 3.23e-101 305 46 5 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W9T9 3.23e-101 305 46 5 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q0VMD9 3.88e-101 305 44 5 346 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
C1DLP4 9.49e-101 303 45 5 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B0KL04 5.01e-100 301 46 5 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas putida (strain GB-1)
A1U4D3 5.33e-99 299 45 7 354 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q21H92 7.28e-96 291 43 5 348 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A4XPX8 1.2e-95 290 46 4 347 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas mendocina (strain ymp)
Q9HUL3 2.05e-95 290 46 3 343 1 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02F66 2.28e-95 290 46 3 343 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V341 2.28e-95 290 46 3 343 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pseudomonas aeruginosa (strain LESB58)
Q1QY34 1.43e-93 285 47 6 345 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q82Y12 2.67e-72 230 40 5 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P67678 2.1e-64 209 40 7 305 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P67680 2.1e-64 209 40 7 305 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P67679 2.1e-64 209 40 7 305 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2YB53 9.39e-63 205 37 7 303 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B2JF36 3.35e-61 201 38 7 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B2U8L7 4.71e-61 201 38 6 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Ralstonia pickettii (strain 12J)
Q8Y0V3 6.78e-61 201 40 6 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B3QL20 4.63e-59 196 39 8 316 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q8KC52 8.09e-59 195 37 8 318 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A1V6I6 3.83e-57 191 35 7 317 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Burkholderia mallei (strain SAVP1)
Q62M59 3.83e-57 191 35 7 317 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Burkholderia mallei (strain ATCC 23344)
A2S4N1 3.83e-57 191 35 7 317 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Burkholderia mallei (strain NCTC 10229)
A3MHS6 3.83e-57 191 35 7 317 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Burkholderia mallei (strain NCTC 10247)
Q13VF6 7e-57 190 37 8 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Paraburkholderia xenovorans (strain LB400)
Q63S39 1.97e-56 189 35 7 317 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Burkholderia pseudomallei (strain K96243)
Q3JQ14 3.79e-56 188 35 7 317 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Burkholderia pseudomallei (strain 1710b)
A3NBZ8 3.87e-56 188 35 7 317 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Burkholderia pseudomallei (strain 668)
A3NXT4 3.87e-56 188 35 7 317 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Burkholderia pseudomallei (strain 1106a)
B2T600 4.86e-56 188 36 8 321 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A4IM52 6.84e-56 187 37 6 291 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Geobacillus thermodenitrificans (strain NG80-2)
C5D8S1 9.34e-56 186 38 7 291 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Geobacillus sp. (strain WCH70)
A5EV96 2.42e-55 186 34 7 329 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Dichelobacter nodosus (strain VCS1703A)
Q5L0R8 2.64e-54 183 38 7 291 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Geobacillus kaustophilus (strain HTA426)
Q5LHL3 1.18e-53 182 32 6 317 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A6GW90 2.59e-53 181 32 6 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
C1ABL6 4.91e-53 180 41 5 260 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
A5FML2 5.61e-53 180 32 6 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q819U6 8.11e-53 179 35 7 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9K7Z8 1.05e-52 179 35 8 301 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q7UUZ6 1.17e-52 179 33 6 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q9K9Z1 1.27e-52 178 37 10 308 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q64YJ1 1.96e-52 178 31 6 317 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Bacteroides fragilis (strain YCH46)
A7GRJ1 3.02e-52 177 35 7 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A5ILF8 3.63e-52 177 35 9 298 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9X242 4.22e-52 177 35 9 298 1 rsgA Small ribosomal subunit biogenesis GTPase RsgA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A6L1H7 1.23e-51 176 32 6 317 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q732K9 1.33e-51 176 36 8 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81WH7 1.8e-51 176 36 8 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Bacillus anthracis
Q8A5I9 6.92e-51 174 32 6 317 3 rsgA2 Small ribosomal subunit biogenesis GTPase RsgA 2 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q11RI7 3.63e-50 172 38 2 216 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A1KRU2 8.4e-49 169 36 8 298 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q2RK09 1.42e-48 168 37 10 315 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A7Z4J8 2.61e-48 167 35 9 293 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A6LHB6 7.55e-48 166 33 8 317 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q9K1A4 9.2e-48 166 35 8 298 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B4RPG3 1.01e-47 166 36 8 298 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Neisseria gonorrhoeae (strain NCCP11945)
Q5F633 1.18e-47 166 36 8 298 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q03W20 2.16e-47 165 33 8 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
O66555 2.24e-47 165 40 5 240 1 rsgA Small ribosomal subunit biogenesis GTPase RsgA Aquifex aeolicus (strain VF5)
A8FD43 4.11e-47 164 35 9 304 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Bacillus pumilus (strain SAFR-032)
P59946 5.34e-47 164 33 7 309 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q8DVW1 1.49e-46 162 33 12 309 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B2RLV5 2.14e-46 163 32 7 309 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q9JSM2 3.03e-46 162 35 8 298 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5WFL1 4.07e-46 161 34 9 307 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Shouchella clausii (strain KSM-K16)
O34530 4.13e-46 162 34 9 293 1 rsgA Small ribosomal subunit biogenesis GTPase RsgA Bacillus subtilis (strain 168)
A9M3C0 4.49e-46 162 34 8 307 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Neisseria meningitidis serogroup C (strain 053442)
Q9A1H9 5.94e-46 161 33 11 308 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Streptococcus pyogenes serotype M1
Q82ZE1 6.84e-46 161 34 9 293 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Enterococcus faecalis (strain ATCC 700802 / V583)
Q8P2N7 7.75e-46 160 33 11 308 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XDX3 7.75e-46 160 33 11 308 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q3AC25 3.39e-45 159 32 7 304 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q8E3D9 3.58e-45 159 33 12 309 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Streptococcus agalactiae serotype III (strain NEM316)
A0LY86 5.91e-45 159 28 6 308 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
P0DF43 8.63e-45 158 32 11 308 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DF42 8.63e-45 158 32 11 308 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q38XT2 1.36e-44 157 31 6 284 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Latilactobacillus sakei subsp. sakei (strain 23K)
Q8R9T7 6.7e-44 155 37 4 229 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B9DPK4 1e-43 155 36 6 249 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Staphylococcus carnosus (strain TM300)
P67685 1.12e-43 155 33 12 309 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P67684 1.12e-43 155 33 12 309 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8DXR9 1.54e-43 155 33 12 309 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
B6YS07 3.53e-43 154 28 6 318 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Azobacteroides pseudotrichonymphae genomovar. CFP2
Q03FX9 1.27e-42 153 32 6 284 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B1MXU5 1.53e-42 152 32 9 316 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Leuconostoc citreum (strain KM20)
Q8ER21 1.68e-42 152 35 6 270 3 rsgA2 Small ribosomal subunit biogenesis GTPase RsgA 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B2V4B8 2.53e-42 151 34 9 273 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium botulinum (strain Alaska E43 / Type E3)
B2THS4 2.96e-42 151 34 9 273 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium botulinum (strain Eklund 17B / Type B)
Q71YJ7 4.13e-42 151 33 11 309 3 rsgA1 Small ribosomal subunit biogenesis GTPase RsgA 1 Listeria monocytogenes serotype 4b (strain F2365)
Q92AI9 5.1e-42 150 33 11 309 3 rsgA2 Small ribosomal subunit biogenesis GTPase RsgA 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y680 8.57e-42 150 33 11 309 3 rsgA2 Small ribosomal subunit biogenesis GTPase RsgA 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8CSV8 1.5e-41 149 34 6 249 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8PTZ6 4.13e-41 150 35 9 307 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q5HPX0 6.31e-41 148 34 6 249 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8TKG2 6.7e-41 150 36 8 275 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8XJL9 1.16e-40 147 33 10 289 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium perfringens (strain 13 / Type A)
Q662R3 1.37e-40 147 36 6 241 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q0SS84 1.37e-40 147 33 10 289 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium perfringens (strain SM101 / Type A)
Q9CEB7 1.98e-40 147 30 10 315 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Lactococcus lactis subsp. lactis (strain IL1403)
Q0TPL7 4.81e-40 145 33 10 289 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B7J132 8.36e-40 145 36 5 225 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Borreliella burgdorferi (strain ZS7)
O51126 8.36e-40 145 36 5 225 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q0SP65 1.57e-39 145 37 5 225 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Borreliella afzelii (strain PKo)
Q82LC4 1.85e-39 146 37 4 220 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
C5CSN3 3.16e-39 144 33 9 308 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Variovorax paradoxus (strain S110)
Q49X02 5.23e-39 143 31 6 249 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A5N7Y7 1.57e-38 141 31 5 250 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E1E8 1.57e-38 141 31 5 250 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium kluyveri (strain NBRC 12016)
Q88WK9 2.43e-38 141 32 7 283 3 rsgA1 Small ribosomal subunit biogenesis GTPase RsgA 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B2GD51 3.14e-38 141 33 8 286 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q88WF3 3.54e-38 142 34 7 244 3 rsgA2 Small ribosomal subunit biogenesis GTPase RsgA 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B8I262 4.1e-38 141 34 4 233 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q9ZBT9 6.88e-38 142 38 5 219 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A6LSK4 1.46e-37 139 32 11 301 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q895P5 2.07e-37 139 28 9 300 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium tetani (strain Massachusetts / E88)
A0Q109 3.02e-37 138 30 8 304 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium novyi (strain NT)
B0JW21 3.09e-37 140 34 8 277 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q97IC1 3.4e-37 138 31 5 251 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A6TRW0 1.11e-36 137 31 4 231 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Alkaliphilus metalliredigens (strain QYMF)
C3L0K4 1.37e-36 136 28 5 250 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium botulinum (strain 657 / Type Ba4)
A7GG89 1.82e-36 136 28 5 250 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IIL4 1.82e-36 136 28 5 250 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium botulinum (strain Okra / Type B1)
B1KX53 2.25e-36 136 28 5 250 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium botulinum (strain Loch Maree / Type A3)
C1FSS3 2.25e-36 136 28 5 250 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium botulinum (strain Kyoto / Type A2)
A5I4T1 2.25e-36 136 28 5 250 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FW69 2.25e-36 136 28 5 250 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Clostridium botulinum (strain ATCC 19397 / Type A)
Q4L5S2 9.92e-36 134 30 6 249 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Staphylococcus haemolyticus (strain JCSC1435)
C4ZEV1 2.2e-35 134 31 8 295 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q87FP9 3.19e-35 134 35 7 242 3 rsgA2 Small ribosomal subunit biogenesis GTPase RsgA 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5RQS6 6.41e-35 132 33 5 224 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Borrelia recurrentis (strain A1)
B5RLH3 6.41e-35 132 33 5 224 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Borrelia duttonii (strain Ly)
Q6GHL4 9.1e-35 132 32 7 249 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Staphylococcus aureus (strain MRSA252)
Q7VEJ4 1.34e-34 132 33 9 269 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q9KX08 1.78e-34 131 31 9 286 1 rsgA Small ribosomal subunit biogenesis GTPase RsgA Staphylococcus aureus (strain COL)
Q8EUL6 1.85e-34 130 31 8 247 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Malacoplasma penetrans (strain HF-2)
Q8YUA3 2.37e-34 132 32 9 276 3 rsgA1 Small ribosomal subunit biogenesis GTPase RsgA 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3MG79 2.65e-34 132 32 9 276 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P67683 3.36e-34 130 31 9 286 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Staphylococcus aureus (strain MW2)
Q6G9Z2 3.36e-34 130 31 9 286 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Staphylococcus aureus (strain MSSA476)
P67682 3.36e-34 130 31 9 286 1 rsgA Small ribosomal subunit biogenesis GTPase RsgA Staphylococcus aureus (strain N315)
P67681 3.36e-34 130 31 9 286 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Staphylococcus aureus (strain Mu50 / ATCC 700699)
B3R0A1 3.96e-34 130 26 10 313 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Phytoplasma mali (strain AT)
B2G835 6.88e-34 129 32 8 284 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VKQ1 6.88e-34 129 32 8 284 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Limosilactobacillus reuteri (strain DSM 20016)
Q3A0G9 9.06e-34 130 34 7 243 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q74IN3 1.83e-33 128 31 12 305 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A5IY02 3.98e-33 127 29 6 243 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
Q92C22 4.47e-33 129 31 6 254 3 rsgA1 Small ribosomal subunit biogenesis GTPase RsgA 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q044G6 6.94e-33 127 28 9 304 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8D4Q0 1.13e-32 127 33 6 239 3 rsgA2 Small ribosomal subunit biogenesis GTPase RsgA 2 Vibrio vulnificus (strain CMCP6)
Q8ETB7 1.15e-32 127 30 4 229 3 rsgA1 Small ribosomal subunit biogenesis GTPase RsgA 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8Y7F0 1.97e-32 127 32 5 247 3 rsgA1 Small ribosomal subunit biogenesis GTPase RsgA 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71ZZ0 2.14e-32 127 31 5 247 3 rsgA2 Small ribosomal subunit biogenesis GTPase RsgA 2 Listeria monocytogenes serotype 4b (strain F2365)
B1ZUH7 4.8e-32 126 32 5 251 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Q7MGA2 1.54e-31 124 32 6 239 3 rsgA2 Small ribosomal subunit biogenesis GTPase RsgA 2 Vibrio vulnificus (strain YJ016)
Q8EZ61 2.38e-31 124 31 9 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72MK0 3.16e-31 124 31 9 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A2BZC2 3.62e-31 122 32 7 237 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Prochlorococcus marinus (strain NATL1A)
Q8DK79 3.83e-31 123 29 9 295 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q46I43 7.84e-31 122 32 8 246 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Prochlorococcus marinus (strain NATL2A)
Q6YR36 2.82e-30 120 29 6 243 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Onion yellows phytoplasma (strain OY-M)
Q2NIT9 5.52e-30 119 29 7 272 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Aster yellows witches'-broom phytoplasma (strain AYWB)
Q5FJH9 5.58e-30 119 28 8 293 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B5ZB25 1.6e-29 118 29 8 252 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
Q8R685 1.68e-29 117 30 8 290 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8YK41 3.57e-29 118 32 5 221 3 rsgA2 Small ribosomal subunit biogenesis GTPase RsgA 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A8YVV8 5.78e-29 116 29 8 293 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Lactobacillus helveticus (strain DPC 4571)
A2C5M0 6.52e-29 117 35 10 264 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Prochlorococcus marinus (strain MIT 9303)
P59945 9.41e-29 115 34 8 222 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
B1AIK5 1.06e-28 115 29 7 243 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Q0IE58 1.08e-28 115 32 9 270 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Synechococcus sp. (strain CC9311)
Q8P5H9 1.18e-28 117 35 7 218 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RNZ3 1.18e-28 117 35 7 218 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Xanthomonas campestris pv. campestris (strain B100)
Q4UYJ6 1.18e-28 117 35 7 218 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Xanthomonas campestris pv. campestris (strain 8004)
P52640 1.94e-28 116 34 8 251 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q3BPG1 6.06e-28 115 34 7 218 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q3ANM7 8.03e-28 113 31 10 289 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Synechococcus sp. (strain CC9605)
Q8PGW9 8.81e-28 114 34 7 218 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Xanthomonas axonopodis pv. citri (strain 306)
Q9PQS5 1.18e-27 113 29 8 243 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q4AAI2 3.87e-27 111 26 6 242 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q601H2 4.07e-27 111 26 6 242 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Mesomycoplasma hyopneumoniae (strain 232)
Q8A8H7 4.56e-27 112 30 8 266 3 rsgA1 Small ribosomal subunit biogenesis GTPase RsgA 1 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B2SLQ8 5.7e-27 112 34 7 218 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q7V9C6 6.17e-27 111 34 10 267 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Prochlorococcus marinus (strain MIT 9313)
Q5H3X2 7.48e-27 112 34 7 218 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P6S9 7.48e-27 112 34 7 218 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q9PFV1 2.61e-26 110 33 4 215 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Xylella fastidiosa (strain 9a5c)
B0U466 6.01e-26 109 33 4 218 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Xylella fastidiosa (strain M12)
B2I7R5 1.26e-25 108 33 4 215 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Xylella fastidiosa (strain M23)
Q87B73 2.24e-25 107 33 4 215 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B1V9R1 1.1e-24 105 28 6 247 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Phytoplasma australiense
Q98JM4 1.24e-24 105 31 5 221 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q4A8L3 5.76e-24 102 26 6 242 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Mesomycoplasma hyopneumoniae (strain 7448)
Q7UA74 1.51e-23 102 31 10 273 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Parasynechococcus marenigrum (strain WH8102)
Q4V399 1.54e-22 101 26 8 314 2 rsgA Small ribosomal subunit biogenesis GTPase RsgA 1, mitochondrial Arabidopsis thaliana
Q98PN8 9e-22 96 25 9 280 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Mycoplasmopsis pulmonis (strain UAB CTIP)
P75523 1.02e-21 96 25 11 306 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47356 1.91e-19 90 27 12 265 3 rsgA Small ribosomal subunit biogenesis GTPase RsgA Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q44557 6.13e-13 66 50 0 56 4 None Uncharacterized protein in rhdA 5'region (Fragment) Azotobacter vinelandii
F4HTL8 8.49e-08 56 30 6 169 2 At1g67460 Small ribosomal subunit biogenesis GTPase RsgA 2, mitochondrial Arabidopsis thaliana
Q9WZM6 0.000269 45 25 5 120 1 rbgA Ribosome biogenesis GTPase A Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09625
Feature type CDS
Gene rsgA
Product small ribosomal subunit biogenesis GTPase RsgA
Location 28648 - 29697 (strand: -1)
Length 1050 (nucleotides) / 349 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1414
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03193 RsgA GTPase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1162 Translation, ribosomal structure and biogenesis (J) J Ribosome biogenesis GTPase RsgA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06949 ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100] Thiamine metabolism
Metabolic pathways
-

Protein Sequence

MAKQKLSKGQERRVQANQQRTLRRERKPEPDDSLFGDALEGLVISRFGQHADIEASDGTVQRCNMRRTIKSLVTGDRVLWRPALKNAETGRVNGIVEAVHDRQSVLTRPDLYDGIKPIAANIDQIVIVSAILPELSLNIIDRYLVACEKVGVEPLIVLNKIDLLDDESRVRVNKLMNIYRNIGYRVLEVSGHSGEGMDALVAELADRISIFAGQSGVGKSSLLNKLLPEMDDILVNDVSDNSGLGQHTTTASRLYHFPHGGDVIDSPGVREFGLWHLTPEQVTLGFTEFREYLGHCKFRDCKHGDDPGCALRDAVEKGKICKERFENYHRILESMAQVKPRRNFTVGED

Flanking regions ( +/- flanking 50bp)

CACAAAGACCGTACCTTCATAATATAGTATTACAGACAGACGAGGTTTCGTTGGCTAAACAAAAACTTTCCAAAGGTCAGGAACGGCGTGTTCAGGCGAATCAGCAGCGGACACTGCGCCGGGAGCGGAAGCCTGAGCCAGATGACAGCCTGTTCGGTGACGCCCTGGAAGGGTTGGTTATCAGCCGGTTTGGTCAGCACGCCGATATTGAAGCGTCTGACGGCACGGTACAGCGCTGTAATATGCGCCGCACCATCAAATCCCTGGTGACCGGCGACCGGGTGCTTTGGCGCCCTGCTCTGAAAAATGCAGAAACCGGACGTGTAAACGGTATTGTTGAAGCCGTACATGATCGCCAATCTGTTCTGACCCGCCCCGATCTTTATGACGGTATTAAGCCTATTGCGGCGAATATTGATCAAATTGTCATTGTCTCCGCGATTTTACCGGAGCTGTCACTCAATATCATTGACCGTTACCTGGTTGCCTGCGAAAAAGTGGGGGTCGAGCCGCTTATCGTCCTGAATAAAATTGATCTTCTGGATGACGAAAGCCGCGTCCGCGTCAATAAATTAATGAACATCTATCGTAATATCGGATACCGGGTTCTGGAAGTCTCAGGTCACTCAGGTGAAGGGATGGATGCGCTTGTTGCCGAACTGGCAGACCGGATTTCTATTTTTGCCGGGCAGTCCGGTGTGGGTAAATCCAGCTTACTGAATAAGTTATTGCCGGAAATGGATGACATTCTGGTTAATGACGTTTCTGATAACTCAGGGCTGGGACAACACACCACAACCGCCTCACGGCTGTATCATTTCCCGCATGGCGGGGATGTGATTGATTCTCCGGGTGTGCGTGAGTTTGGTCTGTGGCACCTGACACCGGAACAGGTCACTCTCGGGTTTACCGAGTTTCGTGAATATCTGGGCCACTGTAAATTCCGCGACTGCAAACACGGGGATGACCCCGGCTGCGCCCTGCGGGATGCCGTGGAAAAGGGTAAAATCTGCAAAGAACGCTTTGAAAATTATCACCGGATCCTGGAAAGTATGGCTCAGGTTAAACCACGCCGTAACTTTACGGTCGGTGAAGACTGACAAGCGCAATAAGCACAGGTACAATAGCCCCCTTTTGTTCAGATTTCGCC