Homologs in group_396

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15400 FBDBKF_15400 32.9 Morganella morganii S1 rbsB ribose ABC transporter substrate-binding protein RbsB
EHELCC_15760 EHELCC_15760 32.9 Morganella morganii S2 rbsB ribose ABC transporter substrate-binding protein RbsB
NLDBIP_16610 NLDBIP_16610 32.9 Morganella morganii S4 rbsB ribose ABC transporter substrate-binding protein RbsB
LHKJJB_16195 LHKJJB_16195 32.9 Morganella morganii S3 rbsB ribose ABC transporter substrate-binding protein RbsB
HKOGLL_15965 HKOGLL_15965 32.9 Morganella morganii S5 rbsB ribose ABC transporter substrate-binding protein RbsB
F4V73_RS17745 F4V73_RS17745 33.6 Morganella psychrotolerans rbsB ribose ABC transporter substrate-binding protein RbsB
PMI_RS00430 PMI_RS00430 31.9 Proteus mirabilis HI4320 rbsB ribose ABC transporter substrate-binding protein RbsB

Distribution of the homologs in the orthogroup group_396

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_396

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9I2F8 2.1e-51 175 35 4 295 1 rbsB D-ribose/D-allose-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P39265 2.19e-45 159 34 5 308 1 alsB D-allose-binding periplasmic protein Escherichia coli (strain K12)
P0A2C5 1.61e-43 154 33 6 304 1 rbsB Ribose import binding protein RbsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2C6 1.61e-43 154 33 6 304 3 rbsB Ribose import binding protein RbsB Salmonella typhi
P02925 2.69e-42 150 33 6 304 1 rbsB Ribose import binding protein RbsB Escherichia coli (strain K12)
P36949 1.49e-37 138 34 5 244 1 rbsB Ribose import binding protein RbsB Bacillus subtilis (strain 168)
P44737 2.79e-33 127 30 6 303 1 rbsB Ribose import binding protein RbsB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0QYB5 2.11e-31 123 31 7 300 1 thpA D-threitol-binding protein Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A6VKQ8 7.82e-30 118 30 6 309 1 Asuc_0175 D-apiose import binding protein Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q2JZQ5 8.76e-28 112 30 4 281 1 RHE_PF00037 D-apiose import binding protein Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A0QYB3 1.28e-27 113 29 6 288 1 xypA Xylitol-binding protein Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P49308 4.59e-27 110 28 8 314 3 mocB Putative rhizopine-binding protein Rhizobium meliloti
B1G898 6.01e-27 110 30 5 301 1 BgramDRAFT_5566 D-apiose import binding protein Paraburkholderia graminis (strain ATCC 700544 / DSM 17151 / LMG 18924 / NCIMB 13744 / C4D1M)
B9JK76 1.76e-26 109 30 5 307 3 Arad_9233 D-apiose import binding protein Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
P45047 3.04e-21 95 28 9 319 3 xylF D-xylose-binding periplasmic protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P37387 9.58e-19 88 28 8 306 1 xylF D-xylose-binding periplasmic protein Escherichia coli (strain K12)
Q9F9B2 3.19e-17 84 27 6 296 1 frcB Fructose import binding protein FrcB Rhizobium meliloti
P39325 2.78e-16 81 29 5 220 1 ytfQ Galactofuranose-binding protein YtfQ Escherichia coli (strain K12)
Q8G848 7.62e-15 77 26 5 238 1 fruE Fructose import binding protein FruE Bifidobacterium longum (strain NCC 2705)
Q4J710 1.57e-12 70 25 7 272 1 xylF Xylose/arabinose-binding protein XylF Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
P23905 4.5e-12 69 26 10 283 1 mglB D-galactose/methyl-galactoside binding periplasmic protein MglB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q65TP0 1.01e-11 68 25 11 304 3 purR HTH-type transcriptional repressor PurR Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P23925 1.04e-11 68 24 9 298 3 mglB D-galactose/methyl-galactoside binding periplasmic protein MglB Citrobacter freundii
Q9CN88 2.06e-11 67 25 12 293 3 purR HTH-type transcriptional repressor PurR Pasteurella multocida (strain Pm70)
P0AEE7 5e-11 66 25 10 283 3 mglB D-galactose/methyl-galactoside binding periplasmic protein MglB Shigella flexneri
P0AEE5 5e-11 66 25 10 283 1 mglB D-galactose/methyl-galactoside binding periplasmic protein MglB Escherichia coli (strain K12)
P0AEE6 5e-11 66 25 10 283 3 mglB D-galactose/methyl-galactoside binding periplasmic protein MglB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A6VNL0 4.25e-10 63 24 10 281 3 purR HTH-type transcriptional repressor PurR Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P77269 2.17e-09 61 22 9 273 1 yphF ABC transporter periplasmic-binding protein YphF Escherichia coli (strain K12)
P55568 5.35e-09 60 26 8 252 3 NGR_a02500 Probable ABC transporter periplasmic-binding protein y4mI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P25548 1.13e-08 59 25 8 266 1 chvE Multiple sugar-binding periplasmic receptor ChvE Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0I4B4 2.19e-08 58 23 10 312 3 purR HTH-type transcriptional repressor PurR Histophilus somni (strain 129Pt)
P39343 3.61e-08 57 22 7 239 4 idnR HTH-type transcriptional regulator IdnR Escherichia coli (strain K12)
A5UCM9 7.27e-08 56 22 9 297 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain PittEE)
Q4QL70 7.27e-08 56 22 9 297 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain 86-028NP)
Q5PJE4 7.72e-08 56 24 9 276 3 lsrB Autoinducer 2-binding protein LsrB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZKQ1 1.62e-07 55 24 9 276 1 lsrB Autoinducer 2-binding protein LsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z2X8 1.66e-07 55 24 9 276 1 lsrB Autoinducer 2-binding protein LsrB Salmonella typhi
A9MZG4 1.71e-07 55 24 9 276 3 lsrB Autoinducer 2-binding protein LsrB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q57HE0 1.79e-07 55 24 9 276 3 lsrB Autoinducer 2-binding protein LsrB Salmonella choleraesuis (strain SC-B67)
B0UUN7 1.81e-07 55 23 10 312 3 purR HTH-type transcriptional repressor PurR Histophilus somni (strain 2336)
P25748 1.87e-07 55 23 8 242 1 galS HTH-type transcriptional regulator GalS Escherichia coli (strain K12)
P44883 2.97e-07 54 24 9 279 1 mglB D-galactose/methyl-galactoside binding periplasmic protein MglB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KBQ0 3.25e-07 54 24 10 244 3 araR Arabinose metabolism transcriptional repressor Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B0BP99 4.76e-07 54 21 12 298 3 purR HTH-type transcriptional repressor PurR Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H1F6 4.8e-07 54 21 12 298 3 purR HTH-type transcriptional repressor PurR Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0H9 4.8e-07 54 21 12 298 3 purR HTH-type transcriptional repressor PurR Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A5UIZ0 5.26e-07 53 22 9 297 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain PittGG)
P0C888 5.78e-07 53 24 10 274 3 lsrB Autoinducer 2-binding protein LsrB Shigella flexneri serotype 5b (strain 8401)
A7ZLX3 5.78e-07 53 24 10 274 3 lsrB Autoinducer 2-binding protein LsrB Escherichia coli O139:H28 (strain E24377A / ETEC)
P0C887 6.16e-07 53 24 10 274 3 lsrB Autoinducer 2-binding protein LsrB Shigella flexneri
B1LF99 7.26e-07 53 24 10 274 3 lsrB Autoinducer 2-binding protein LsrB Escherichia coli (strain SMS-3-5 / SECEC)
Q8XAY9 7.26e-07 53 24 10 274 3 lsrB Autoinducer 2-binding protein LsrB Escherichia coli O157:H7
P76142 7.39e-07 53 24 10 274 1 lsrB Autoinducer 2-binding protein LsrB Escherichia coli (strain K12)
B1XEA4 7.39e-07 53 24 10 274 3 lsrB Autoinducer 2-binding protein LsrB Escherichia coli (strain K12 / DH10B)
P46456 7.57e-07 53 23 10 297 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P41030 9.27e-07 53 24 11 262 3 galS HTH-type transcriptional regulator GalS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9K6K2 1.12e-06 53 20 8 272 3 rbsR Ribose operon repressor Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9I1F6 1.32e-06 52 24 10 241 1 gntR HTH-type transcriptional regulator GntR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P54082 1.46e-06 52 24 9 281 3 chvE Multiple sugar-binding periplasmic receptor ChvE Rhizobium radiobacter
B1IRU4 3.02e-06 51 25 9 260 3 lsrB Autoinducer 2-binding protein LsrB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
C5BE45 4.3e-06 51 23 10 282 3 purR HTH-type transcriptional repressor PurR Edwardsiella ictaluri (strain 93-146)
A8A069 8.85e-06 50 24 10 274 3 lsrB Autoinducer 2-binding protein LsrB Escherichia coli O9:H4 (strain HS)
Q9JMQ1 1.3e-05 49 32 3 109 2 exuR Probable HTH-type transcriptional repressor ExuR Bacillus subtilis (strain 168)
A1JJ52 1.46e-05 49 24 9 273 3 lsrB Autoinducer 2-binding protein LsrB Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7VL44 1.49e-05 49 21 13 298 3 purR HTH-type transcriptional repressor PurR Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A7N1L2 1.65e-05 49 22 9 291 3 purR HTH-type transcriptional repressor PurR Vibrio campbellii (strain ATCC BAA-1116)
Q2PBM5 2.32e-05 48 24 10 279 3 lsrB Autoinducer 2-binding protein LsrB Photorhabdus temperata
B8F4D0 2.92e-05 48 22 13 310 3 purR HTH-type transcriptional repressor PurR Glaesserella parasuis serovar 5 (strain SH0165)
A4TQL8 3.68e-05 48 23 9 272 3 lsrB Autoinducer 2-binding protein LsrB Yersinia pestis (strain Pestoides F)
Q1CN18 3.68e-05 48 23 9 272 3 lsrB Autoinducer 2-binding protein LsrB Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0S5 3.68e-05 48 23 9 272 3 lsrB Autoinducer 2-binding protein LsrB Yersinia pestis bv. Antiqua (strain Angola)
Q74PW2 3.68e-05 48 23 9 272 1 lsrB Autoinducer 2-binding protein LsrB Yersinia pestis
Q1C135 3.68e-05 48 23 9 272 3 lsrB Autoinducer 2-binding protein LsrB Yersinia pestis bv. Antiqua (strain Antiqua)
Q66EZ2 4.69e-05 48 23 9 272 3 lsrB Autoinducer 2-binding protein LsrB Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K3F8 4.69e-05 48 23 9 272 3 lsrB Autoinducer 2-binding protein LsrB Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JLQ3 5e-05 48 23 9 274 3 lsrB Autoinducer 2-binding protein LsrB Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FMK0 5e-05 48 23 9 274 3 lsrB Autoinducer 2-binding protein LsrB Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JJ59 6.88e-05 47 33 4 118 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66A32 6.88e-05 47 33 4 118 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIQ4 6.88e-05 47 33 4 118 3 purR HTH-type transcriptional repressor PurR Yersinia pestis (strain Pestoides F)
Q1CIL0 6.88e-05 47 33 4 118 3 purR HTH-type transcriptional repressor PurR Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZB3 6.88e-05 47 33 4 118 3 purR HTH-type transcriptional repressor PurR Yersinia pestis bv. Antiqua (strain Angola)
Q7CIS2 6.88e-05 47 33 4 118 3 purR HTH-type transcriptional repressor PurR Yersinia pestis
B2K5I4 6.88e-05 47 33 4 118 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FHK2 6.88e-05 47 33 4 118 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q87QW9 7.47e-05 47 26 4 165 3 purR HTH-type transcriptional repressor PurR Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MJ57 8.78e-05 47 23 11 300 3 purR HTH-type transcriptional repressor PurR Vibrio vulnificus (strain YJ016)
Q8DAQ5 8.78e-05 47 23 11 300 3 purR HTH-type transcriptional repressor PurR Vibrio vulnificus (strain CMCP6)
C3LN44 0.00012 46 21 11 294 3 purR HTH-type transcriptional repressor PurR Vibrio cholerae serotype O1 (strain M66-2)
Q9KRC1 0.00012 46 21 11 294 3 purR HTH-type transcriptional repressor PurR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F7H0 0.00012 46 21 11 294 3 purR HTH-type transcriptional repressor PurR Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q1C774 0.000254 45 33 4 118 3 purR HTH-type transcriptional repressor PurR Yersinia pestis bv. Antiqua (strain Antiqua)
P38683 0.000312 45 23 5 197 1 torT Periplasmic protein TorT Escherichia coli (strain K12)
P58358 0.000324 45 23 5 197 3 torT Periplasmic protein TorT Escherichia coli O157:H7
P02924 0.00035 45 20 10 320 1 araF L-arabinose-binding periplasmic protein Escherichia coli (strain K12)
A1JP52 0.00037 45 31 4 118 3 purR HTH-type transcriptional repressor PurR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7MB18 0.000571 44 23 8 255 3 lsrB Autoinducer 2-binding protein LsrB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P24242 0.000698 44 24 9 225 1 ascG HTH-type transcriptional regulator AscG Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09115
Feature type CDS
Gene -
Product substrate-binding domain-containing protein
Location 1906365 - 1907291 (strand: -1)
Length 927 (nucleotides) / 308 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_396
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF13407 Periplasmic binding protein domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1879 Carbohydrate transport and metabolism (G) G ABC-type sugar transport system, periplasmic component, contains N-terminal xre family HTH domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K10439 ribose transport system substrate-binding protein ABC transporters
Bacterial chemotaxis		 -

Protein Sequence

MKRLFQSLLAAIVLVGFTAVAQAEKPKVALIMKTLSNEYFIAMKEGADKAAKEQNIDLIVQVAEKENSTEELVSLVENMIASKIDAIVVTPNDSHAFVSVFKDAEKAGIPIIDLDVELDKTSAQSAGLTYYYVGVNNFDGGYKSAKRLVDELGGKGKVVILEGIPGVDNGEQRKAGAMKAFSEAPGIEVVASQTANWETEQALNVMTNILTANPDINGVFAANDNMAIGAITAIENAGFEGKILVSGYDALPLALQYIKEGKMLNTIDQGPAAQAAKGLEFAVKRINKEKVPERFYQDLIVIDKSNVK

Flanking regions ( +/- flanking 50bp)

ATGTTGTGCTTTCTCTATCCTACATCAATCAATTAGAGGTGTACATCGGTATGAAACGTCTATTCCAATCACTATTAGCCGCAATCGTATTAGTAGGATTTACTGCTGTTGCCCAGGCAGAAAAACCTAAAGTCGCCCTTATTATGAAAACATTAAGTAATGAATATTTCATTGCAATGAAAGAAGGCGCAGACAAAGCGGCAAAAGAGCAAAACATTGATTTAATTGTTCAGGTTGCTGAAAAAGAAAACTCAACAGAAGAATTAGTCTCATTAGTTGAAAATATGATTGCGTCTAAAATAGATGCGATTGTAGTAACACCGAATGACTCACATGCCTTTGTTTCTGTATTTAAAGATGCGGAAAAGGCCGGTATTCCTATTATTGATTTAGATGTGGAACTGGATAAAACCTCTGCGCAATCAGCAGGTCTGACTTACTATTATGTTGGTGTGAATAACTTTGATGGTGGTTATAAATCAGCAAAACGTCTGGTGGATGAGTTAGGCGGTAAAGGTAAAGTGGTTATTTTAGAAGGTATTCCGGGCGTCGATAATGGCGAGCAACGTAAAGCCGGGGCAATGAAAGCCTTTTCTGAAGCACCGGGTATTGAAGTTGTTGCCTCACAAACTGCCAACTGGGAAACCGAACAGGCTTTAAATGTCATGACTAATATTTTAACCGCAAACCCGGATATCAACGGTGTATTCGCCGCCAATGATAATATGGCAATCGGCGCGATTACCGCGATTGAAAATGCCGGTTTTGAAGGCAAAATATTAGTATCCGGTTATGACGCACTGCCGCTGGCACTTCAGTATATTAAAGAAGGCAAAATGCTCAATACCATTGACCAGGGCCCGGCAGCTCAGGCGGCAAAAGGTCTGGAATTTGCCGTTAAACGTATTAATAAAGAAAAAGTACCTGAGCGTTTCTATCAGGATCTTATCGTGATAGATAAAAGCAATGTGAAATAATAGTCGTCTCACTATACCCAACATCATTCAAGATGCAGGCGGGCTGAGCG