Homologs in group_151

Help

9 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04630 FBDBKF_04630 90.3 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_05920 EHELCC_05920 90.3 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_06240 NLDBIP_06240 90.3 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_03120 LHKJJB_03120 90.3 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_06595 HKOGLL_06595 90.3 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS01640 F4V73_RS01640 36.1 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS02265 F4V73_RS02265 31.9 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS08420 F4V73_RS08420 33.3 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS10915 F4V73_RS10915 30.6 Morganella psychrotolerans - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_151

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_151

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0C5S2 5.2e-13 62 45 0 60 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 5.2e-13 62 45 0 60 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
P15017 7.76e-10 53 37 0 66 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
Q9ZD50 5.86e-08 49 37 0 66 4 RP497 Uncharacterized HTH-type transcriptional regulator RP497 Rickettsia prowazekii (strain Madrid E)
Q92HV3 6.03e-08 48 37 0 66 4 RC0668 Uncharacterized HTH-type transcriptional regulator RC0668 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P55681 2.28e-07 47 32 0 64 4 NGR_a01020 Uncharacterized HTH-type transcriptional regulator y4wC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P16117 4.89e-06 43 36 1 61 1 CI Repressor protein CI (Fragment) Enterobacteria phage 434
Q8TZX4 5.8e-06 45 38 0 55 3 PF1851 Putative HTH-type transcriptional regulatory protein PF1851 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O59472 0.000267 40 34 0 55 3 PH1808 Putative HTH-type transcriptional regulatory protein PH1808 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9V1R0 0.000771 38 32 0 52 3 PYRAB03670 Putative HTH-type transcriptional regulatory protein PYRAB03670 Pyrococcus abyssi (strain GE5 / Orsay)
P55360 0.001 38 35 0 60 4 NGR_a00350 Uncharacterized HTH-type transcriptional regulator y4aM Sinorhizobium fredii (strain NBRC 101917 / NGR234)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09080
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 1899235 - 1899453 (strand: -1)
Length 219 (nucleotides) / 72 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_151
Orthogroup size 10
N. genomes 6

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

METEYIYSCVGSRIKEKRKYLGLSVVRLAEDMGITQQQFNRYERGTSRISIHYLIYLAELFHVPVEYFFNKE

Flanking regions ( +/- flanking 50bp)

AATGGATTTTTTTGTTATCACATTGTCAATATAAGCGAATGGAGTATCTTATGGAGACCGAATATATTTATTCTTGTGTCGGAAGCCGGATTAAAGAAAAGAGAAAATACTTAGGATTAAGTGTTGTCCGGTTAGCTGAAGATATGGGGATAACCCAGCAGCAATTTAACCGTTACGAACGTGGAACAAGCCGTATCAGTATTCATTATCTAATCTATTTGGCTGAATTGTTTCATGTTCCGGTGGAATACTTTTTCAATAAAGAATAGTTCCCCGGTAGTTAAGTCGTGACATGGTACTAACCGTATGTGAAAATGAC