Homologs in group_880

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04525 FBDBKF_04525 94.8 Morganella morganii S1 metK methionine adenosyltransferase
EHELCC_05815 EHELCC_05815 94.8 Morganella morganii S2 metK methionine adenosyltransferase
NLDBIP_06135 NLDBIP_06135 94.8 Morganella morganii S4 metK methionine adenosyltransferase
LHKJJB_03015 LHKJJB_03015 94.8 Morganella morganii S3 metK methionine adenosyltransferase
HKOGLL_06490 HKOGLL_06490 94.8 Morganella morganii S5 metK methionine adenosyltransferase
PMI_RS10320 PMI_RS10320 91.4 Proteus mirabilis HI4320 metK methionine adenosyltransferase

Distribution of the homologs in the orthogroup group_880

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_880

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1A5 0.0 738 91 0 384 3 metK S-adenosylmethionine synthase Proteus mirabilis (strain HI4320)
Q7N119 0.0 732 89 0 384 3 metK S-adenosylmethionine synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A9MRD1 0.0 718 88 0 384 3 metK S-adenosylmethionine synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A7MJQ6 0.0 718 88 0 384 3 metK S-adenosylmethionine synthase Cronobacter sakazakii (strain ATCC BAA-894)
A4WE78 0.0 717 89 0 384 3 metK S-adenosylmethionine synthase Enterobacter sp. (strain 638)
B1JNQ2 0.0 716 88 0 384 3 metK S-adenosylmethionine synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q666P5 0.0 716 88 0 384 3 metK S-adenosylmethionine synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TI83 0.0 716 88 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis (strain Pestoides F)
Q1CEX6 0.0 716 88 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R314 0.0 716 88 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZHG7 0.0 716 88 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis
B2K0S7 0.0 716 88 0 384 3 metK S-adenosylmethionine synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CB69 0.0 716 88 0 384 3 metK S-adenosylmethionine synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FEZ7 0.0 716 88 0 384 3 metK S-adenosylmethionine synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8APG1 0.0 716 88 0 384 3 metK S-adenosylmethionine synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6TDV1 0.0 715 88 0 384 3 metK S-adenosylmethionine synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B2VF06 0.0 715 88 0 384 3 metK S-adenosylmethionine synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q3YXS9 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Shigella sonnei (strain Ss046)
P0A820 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Shigella flexneri
Q0T0V0 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Shigella flexneri serotype 5b (strain 8401)
Q32C11 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Shigella dysenteriae serotype 1 (strain Sd197)
B1LDF1 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain SMS-3-5 / SECEC)
B6I780 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain SE11)
B7N7J5 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A817 0.0 714 88 0 384 1 metK S-adenosylmethionine synthase Escherichia coli (strain K12)
B1IT65 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A818 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TDR0 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A481 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O9:H4 (strain HS)
B1XFA4 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain K12 / DH10B)
C5A0L1 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LYX2 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O8 (strain IAI1)
B7NI05 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQD9 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A819 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O157:H7
B7LFK4 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli (strain 55989 / EAEC)
B7UHY9 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZR64 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
B5XUA8 0.0 714 88 0 384 3 metK S-adenosylmethionine synthase Klebsiella pneumoniae (strain 342)
P66764 0.0 712 88 0 384 3 metK S-adenosylmethionine synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66765 0.0 712 88 0 384 3 metK S-adenosylmethionine synthase Salmonella typhi
B4TV58 0.0 712 88 0 384 3 metK S-adenosylmethionine synthase Salmonella schwarzengrund (strain CVM19633)
B5BFP7 0.0 712 88 0 384 3 metK S-adenosylmethionine synthase Salmonella paratyphi A (strain AKU_12601)
Q5PJJ2 0.0 712 88 0 384 3 metK S-adenosylmethionine synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T5J6 0.0 712 88 0 384 3 metK S-adenosylmethionine synthase Salmonella newport (strain SL254)
B5QY66 0.0 712 88 0 384 3 metK S-adenosylmethionine synthase Salmonella enteritidis PT4 (strain P125109)
Q57K26 0.0 712 88 0 384 3 metK S-adenosylmethionine synthase Salmonella choleraesuis (strain SC-B67)
B7LPQ9 0.0 712 88 0 384 3 metK S-adenosylmethionine synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q31WK4 0.0 712 88 0 384 3 metK S-adenosylmethionine synthase Shigella boydii serotype 4 (strain Sb227)
B2U0W2 0.0 712 88 0 384 3 metK S-adenosylmethionine synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5F5L4 0.0 712 87 0 384 3 metK S-adenosylmethionine synthase Salmonella agona (strain SL483)
B4THH4 0.0 712 88 0 384 3 metK S-adenosylmethionine synthase Salmonella heidelberg (strain SL476)
B5FUK0 0.0 710 87 0 384 3 metK S-adenosylmethionine synthase Salmonella dublin (strain CT_02021853)
B5RE50 0.0 709 87 0 384 3 metK S-adenosylmethionine synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
A8GIX9 0.0 707 87 0 384 3 metK S-adenosylmethionine synthase Serratia proteamaculans (strain 568)
A1JPS4 0.0 706 87 0 384 3 metK S-adenosylmethionine synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6D081 0.0 700 89 0 383 3 metK S-adenosylmethionine synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DFI3 0.0 696 88 0 383 3 metK S-adenosylmethionine synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q2NRD1 0.0 682 84 1 385 3 metK S-adenosylmethionine synthase Sodalis glossinidius (strain morsitans)
Q087Q9 0.0 682 84 0 383 3 metK S-adenosylmethionine synthase Shewanella frigidimarina (strain NCIMB 400)
Q12QA6 0.0 677 84 0 383 3 metK S-adenosylmethionine synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1RN71 0.0 674 83 0 383 3 metK S-adenosylmethionine synthase Shewanella sp. (strain W3-18-1)
A4Y3R7 0.0 674 83 0 383 3 metK S-adenosylmethionine synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
C5BAV4 0.0 674 85 0 384 3 metK S-adenosylmethionine synthase Edwardsiella ictaluri (strain 93-146)
A3QAX5 0.0 673 83 0 383 3 metK S-adenosylmethionine synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8EIB4 0.0 673 83 0 383 3 metK S-adenosylmethionine synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9L1M6 0.0 673 83 0 383 3 metK S-adenosylmethionine synthase Shewanella baltica (strain OS195)
A6WS79 0.0 673 83 0 383 3 metK S-adenosylmethionine synthase Shewanella baltica (strain OS185)
B8E5U7 0.0 673 83 0 383 3 metK S-adenosylmethionine synthase Shewanella baltica (strain OS223)
Q0HRM1 0.0 672 83 0 383 3 metK S-adenosylmethionine synthase Shewanella sp. (strain MR-7)
Q0HM65 0.0 672 83 0 383 3 metK S-adenosylmethionine synthase Shewanella sp. (strain MR-4)
A0L0K9 0.0 672 83 0 383 3 metK S-adenosylmethionine synthase Shewanella sp. (strain ANA-3)
A8FRL1 0.0 671 82 0 383 3 metK S-adenosylmethionine synthase Shewanella sediminis (strain HAW-EB3)
A3D0T8 0.0 671 83 0 383 3 metK S-adenosylmethionine synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q15QK1 0.0 666 83 0 383 3 metK S-adenosylmethionine synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A1S9A6 0.0 666 82 0 383 3 metK S-adenosylmethionine synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B8CU43 0.0 664 82 1 384 3 metK S-adenosylmethionine synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q3IDQ1 0.0 660 81 0 383 3 metK S-adenosylmethionine synthase Pseudoalteromonas translucida (strain TAC 125)
A1SZJ9 0.0 659 82 0 381 3 metK S-adenosylmethionine synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q4QLC5 0.0 658 83 0 384 3 metK S-adenosylmethionine synthase Haemophilus influenzae (strain 86-028NP)
A8H0M7 0.0 658 81 1 384 3 metK S-adenosylmethionine synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A5UIU0 0.0 658 83 0 384 3 metK S-adenosylmethionine synthase Haemophilus influenzae (strain PittGG)
P43762 0.0 657 83 0 384 3 metK S-adenosylmethionine synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B1KF18 0.0 656 81 1 384 3 metK S-adenosylmethionine synthase Shewanella woodyi (strain ATCC 51908 / MS32)
A5UCT6 0.0 655 83 0 384 3 metK S-adenosylmethionine synthase Haemophilus influenzae (strain PittEE)
P57897 0.0 654 82 0 384 3 metK S-adenosylmethionine synthase Pasteurella multocida (strain Pm70)
A6VMK8 0.0 653 83 0 383 3 metK S-adenosylmethionine synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65UT4 0.0 652 83 0 383 3 metK S-adenosylmethionine synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
C4K3W7 0.0 650 80 0 384 3 metK S-adenosylmethionine synthase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B0UWT3 0.0 649 82 0 384 3 metK S-adenosylmethionine synthase Histophilus somni (strain 2336)
Q0I559 0.0 649 82 0 384 3 metK S-adenosylmethionine synthase Histophilus somni (strain 129Pt)
C3LRY9 0.0 647 82 0 381 3 metK S-adenosylmethionine synthase Vibrio cholerae serotype O1 (strain M66-2)
A5F9H4 0.0 647 82 0 381 3 metK S-adenosylmethionine synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KUP3 0.0 647 82 0 381 3 metK S-adenosylmethionine synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B0TUB8 0.0 646 80 1 384 3 metK S-adenosylmethionine synthase Shewanella halifaxensis (strain HAW-EB4)
Q7MHK6 0.0 644 82 0 384 3 metK S-adenosylmethionine synthase Vibrio vulnificus (strain YJ016)
Q8DCA3 0.0 644 82 0 384 3 metK S-adenosylmethionine synthase Vibrio vulnificus (strain CMCP6)
A3N186 0.0 643 82 0 383 3 metK S-adenosylmethionine synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B4RWC7 0.0 642 80 0 378 3 metK S-adenosylmethionine synthase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B0BQ17 0.0 642 82 0 383 3 metK S-adenosylmethionine synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H1W3 0.0 642 82 0 383 3 metK S-adenosylmethionine synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q87LK6 0.0 642 81 0 384 3 metK S-adenosylmethionine synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LMM8 0.0 641 82 0 384 3 metK S-adenosylmethionine synthase Photobacterium profundum (strain SS9)
Q1LU70 0.0 640 79 0 381 3 metK S-adenosylmethionine synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q7VNG7 0.0 637 81 0 380 3 metK S-adenosylmethionine synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B6EMV8 0.0 636 81 0 384 3 metK S-adenosylmethionine synthase Aliivibrio salmonicida (strain LFI1238)
A7MTQ7 0.0 635 80 0 384 3 metK S-adenosylmethionine synthase Vibrio campbellii (strain ATCC BAA-1116)
B8F4B2 0.0 630 81 0 380 3 metK S-adenosylmethionine synthase Glaesserella parasuis serovar 5 (strain SH0165)
B5F9T2 0.0 630 80 0 384 3 metK S-adenosylmethionine synthase Aliivibrio fischeri (strain MJ11)
Q5E7R2 0.0 630 80 0 384 3 metK S-adenosylmethionine synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5QVM7 0.0 627 77 0 378 3 metK S-adenosylmethionine synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q8K9E5 0.0 627 77 0 377 3 metK S-adenosylmethionine synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B7VKB3 0.0 625 80 0 383 3 metK S-adenosylmethionine synthase Vibrio atlanticus (strain LGP32)
B8D7U1 0.0 625 75 0 377 3 metK S-adenosylmethionine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57486 0.0 625 75 0 377 3 metK S-adenosylmethionine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9I9 0.0 625 75 0 377 3 metK S-adenosylmethionine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B1J2Z8 0.0 608 73 2 391 3 metK S-adenosylmethionine synthase Pseudomonas putida (strain W619)
Q1I3X6 0.0 607 73 2 391 3 metK S-adenosylmethionine synthase Pseudomonas entomophila (strain L48)
A6W3D6 0.0 606 76 2 382 3 metK S-adenosylmethionine synthase Marinomonas sp. (strain MWYL1)
Q0A6D3 0.0 604 73 1 385 3 metK S-adenosylmethionine synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q88D60 0.0 604 73 2 391 3 metK S-adenosylmethionine synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KLZ1 0.0 604 73 2 391 3 metK S-adenosylmethionine synthase Pseudomonas putida (strain GB-1)
A5WA00 0.0 604 73 2 391 3 metK S-adenosylmethionine synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q60CG7 0.0 604 76 1 384 3 metK S-adenosylmethionine synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8D2N8 0.0 603 71 0 384 3 metK S-adenosylmethionine synthase Wigglesworthia glossinidia brevipalpis
A1U547 0.0 603 73 1 392 3 metK S-adenosylmethionine synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q486L6 0.0 597 71 1 395 3 metK S-adenosylmethionine synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q31EL0 0.0 596 74 1 385 3 metK S-adenosylmethionine synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A4XPF8 0.0 595 73 2 391 3 metK S-adenosylmethionine synthase Pseudomonas mendocina (strain ymp)
C3K3F5 0.0 593 72 1 391 3 metK S-adenosylmethionine synthase Pseudomonas fluorescens (strain SBW25)
Q3K5E8 0.0 592 73 2 391 3 metK S-adenosylmethionine synthase Pseudomonas fluorescens (strain Pf0-1)
C1DKE3 0.0 591 71 1 391 3 metK S-adenosylmethionine synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q9I5Z0 0.0 591 72 1 391 3 metK S-adenosylmethionine synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TL9 0.0 591 72 1 391 3 metK S-adenosylmethionine synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V4D3 0.0 591 72 1 391 3 metK S-adenosylmethionine synthase Pseudomonas aeruginosa (strain LESB58)
A6UZ09 0.0 591 72 1 391 3 metK S-adenosylmethionine synthase Pseudomonas aeruginosa (strain PA7)
B0RV66 0.0 590 70 2 403 3 metK S-adenosylmethionine synthase Xanthomonas campestris pv. campestris (strain B100)
Q4UR08 0.0 590 70 2 403 3 metK S-adenosylmethionine synthase Xanthomonas campestris pv. campestris (strain 8004)
Q4K4I7 0.0 590 72 2 391 3 metK S-adenosylmethionine synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8PCH3 0.0 588 70 2 403 3 metK S-adenosylmethionine synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
A4VRE8 0.0 588 72 1 391 3 metK S-adenosylmethionine synthase Stutzerimonas stutzeri (strain A1501)
Q1R0L1 0.0 585 70 2 401 3 metK S-adenosylmethionine synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q5ZTY6 0.0 584 72 0 377 3 metK S-adenosylmethionine synthase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IDK5 0.0 584 72 0 377 3 metK S-adenosylmethionine synthase Legionella pneumophila (strain Corby)
Q5X3N0 0.0 584 72 0 377 3 metK S-adenosylmethionine synthase Legionella pneumophila (strain Paris)
Q5WV18 0.0 583 72 0 377 3 metK S-adenosylmethionine synthase Legionella pneumophila (strain Lens)
Q6FAQ6 0.0 582 72 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q3J7R5 0.0 580 71 2 382 3 metK S-adenosylmethionine synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q1QCH2 0.0 578 71 1 384 3 metK S-adenosylmethionine synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q5GW76 0.0 577 70 2 390 3 metK S-adenosylmethionine synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SPP5 0.0 577 70 2 390 3 metK S-adenosylmethionine synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZF1 0.0 577 70 2 390 3 metK S-adenosylmethionine synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BXB7 0.0 577 70 2 390 3 metK S-adenosylmethionine synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PP75 0.0 577 70 2 390 3 metK S-adenosylmethionine synthase Xanthomonas axonopodis pv. citri (strain 306)
Q4FTH7 0.0 576 71 1 384 3 metK S-adenosylmethionine synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
C5BTQ4 0.0 575 72 1 378 3 metK S-adenosylmethionine synthase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q9PGB0 0.0 572 68 2 403 3 metK S-adenosylmethionine synthase Xylella fastidiosa (strain 9a5c)
Q2SLT3 0.0 572 71 1 381 3 metK S-adenosylmethionine synthase Hahella chejuensis (strain KCTC 2396)
B3PGF2 0.0 570 72 1 378 3 metK S-adenosylmethionine synthase Cellvibrio japonicus (strain Ueda107)
A9N9E2 0.0 570 70 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD87 0.0 570 70 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain Dugway 5J108-111)
B6J3Q9 0.0 570 70 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain CbuG_Q212)
B6J6H0 0.0 570 70 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain CbuK_Q154)
B0U4E7 0.0 569 67 2 403 3 metK S-adenosylmethionine synthase Xylella fastidiosa (strain M12)
Q88AK7 0.0 569 70 1 379 3 metK S-adenosylmethionine synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZM01 0.0 568 70 1 379 3 metK S-adenosylmethionine synthase Pseudomonas syringae pv. syringae (strain B728a)
Q0VL83 0.0 568 72 0 376 3 metK S-adenosylmethionine synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q83A78 0.0 568 70 1 383 3 metK S-adenosylmethionine synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A5EY13 0.0 568 72 1 382 3 metK S-adenosylmethionine synthase Dichelobacter nodosus (strain VCS1703A)
Q87AY6 0.0 567 67 2 403 3 metK S-adenosylmethionine synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I898 0.0 567 67 2 403 3 metK S-adenosylmethionine synthase Xylella fastidiosa (strain M23)
Q21NJ5 0.0 566 71 1 376 3 metK S-adenosylmethionine synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q48CH3 0.0 566 70 1 379 3 metK S-adenosylmethionine synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B0VC98 0.0 566 72 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baumannii (strain AYE)
A3M4V2 0.0 565 72 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VR30 0.0 565 72 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baumannii (strain SDF)
B2HYY9 0.0 565 72 1 383 3 metK S-adenosylmethionine synthase Acinetobacter baumannii (strain ACICU)
A5WDU0 0.0 565 70 1 383 3 metK S-adenosylmethionine synthase Psychrobacter sp. (strain PRwf-1)
Q7WYG5 0.0 565 69 0 380 3 metK S-adenosylmethionine synthase Legionella jeonii
B2FPC7 0.0 564 69 2 390 3 metK S-adenosylmethionine synthase Stenotrophomonas maltophilia (strain K279a)
B4SK03 0.0 564 69 2 390 3 metK S-adenosylmethionine synthase Stenotrophomonas maltophilia (strain R551-3)
Q493F2 0.0 564 70 1 386 3 metK S-adenosylmethionine synthase Blochmanniella pennsylvanica (strain BPEN)
Q6AQ43 0.0 562 69 2 387 3 metK S-adenosylmethionine synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A8GPW6 0.0 544 67 1 380 3 metK S-adenosylmethionine synthase Rickettsia akari (strain Hartford)
B5EN11 0.0 539 69 2 386 3 metK S-adenosylmethionine synthase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J551 0.0 539 69 2 386 3 metK S-adenosylmethionine synthase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q7VRG5 0.0 535 66 2 385 3 metK S-adenosylmethionine synthase Blochmanniella floridana
Q3AFS4 0.0 533 64 2 396 3 metK S-adenosylmethionine synthase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q3SFY2 0.0 533 66 2 383 3 metK S-adenosylmethionine synthase Thiobacillus denitrificans (strain ATCC 25259)
P56878 0.0 531 65 1 380 3 metK S-adenosylmethionine synthase Rickettsia prowazekii (strain Madrid E)
Q5KW02 0.0 526 64 3 392 3 metK S-adenosylmethionine synthase Geobacillus kaustophilus (strain HTA426)
Q0AEV7 0.0 526 68 2 387 3 metK S-adenosylmethionine synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A9KL72 0.0 526 65 3 388 3 metK S-adenosylmethionine synthase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B8FSB9 0.0 526 63 2 396 3 metK S-adenosylmethionine synthase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q9RL99 0.0 525 65 1 380 3 metK S-adenosylmethionine synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A5CYJ7 0.0 524 62 2 396 3 metK S-adenosylmethionine synthase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A9IH21 0.0 524 67 2 381 3 metK S-adenosylmethionine synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
C5D6E9 0.0 524 64 3 392 3 metK S-adenosylmethionine synthase Geobacillus sp. (strain WCH70)
Q82WL2 0.0 523 68 2 387 3 metK S-adenosylmethionine synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q1LS34 0.0 523 67 3 383 3 metK S-adenosylmethionine synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A4IRZ1 0.0 521 64 3 392 3 metK S-adenosylmethionine synthase Geobacillus thermodenitrificans (strain NG80-2)
Q476V0 0.0 520 67 3 383 3 metK S-adenosylmethionine synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q7VUL5 0.0 520 66 2 381 3 metK S-adenosylmethionine synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W200 0.0 520 66 2 381 3 metK S-adenosylmethionine synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WQX8 0.0 520 66 2 381 3 metK S-adenosylmethionine synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A6T2Z1 0.0 520 68 3 384 3 metK S-adenosylmethionine synthase Janthinobacterium sp. (strain Marseille)
A1K301 0.0 519 68 2 383 3 metK S-adenosylmethionine synthase Azoarcus sp. (strain BH72)
Q2Y5Z1 0.0 518 65 2 388 3 metK S-adenosylmethionine synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q21RM4 0.0 518 66 3 388 3 metK S-adenosylmethionine synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q7NZF9 0.0 518 69 3 389 3 metK S-adenosylmethionine synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A2SKW6 0.0 516 67 4 388 3 metK S-adenosylmethionine synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
P54419 0.0 514 63 3 392 3 metK S-adenosylmethionine synthase Bacillus subtilis (strain 168)
B1Y6S3 0.0 514 65 3 388 3 metK S-adenosylmethionine synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q5NIC7 0.0 514 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JT0 0.0 514 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. tularensis (strain FSC 198)
Q0BKD0 0.0 513 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. holarctica (strain OSU18)
A0Q862 0.0 513 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. novicida (strain U112)
B2SFE1 0.0 513 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A1N2 0.0 513 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. holarctica (strain LVS)
A7NEB4 0.0 513 66 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B0TX15 0.0 513 65 1 383 3 metK S-adenosylmethionine synthase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q5FAC0 0.0 513 67 3 389 1 metK S-adenosylmethionine synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
C1DCT7 0.0 513 68 3 389 3 metK S-adenosylmethionine synthase Laribacter hongkongensis (strain HLHK9)
Q47JN4 0.0 512 67 2 387 3 metK S-adenosylmethionine synthase Dechloromonas aromatica (strain RCB)
B4RQ36 0.0 511 67 3 389 3 metK S-adenosylmethionine synthase Neisseria gonorrhoeae (strain NCCP11945)
Q0KF39 0.0 510 67 3 383 3 metK S-adenosylmethionine synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A4IWA4 0.0 510 65 1 381 3 metK S-adenosylmethionine synthase Francisella tularensis subsp. tularensis (strain WY96-3418)
A7Z7Y9 1.79e-180 509 63 3 392 3 metK S-adenosylmethionine synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P50307 1.8e-180 509 61 3 392 3 metK S-adenosylmethionine synthase Staphylococcus aureus
Q8NVZ9 4.97e-180 508 61 3 392 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain MW2)
A8Z4L2 4.97e-180 508 61 3 392 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G8E3 4.97e-180 508 61 3 392 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain MSSA476)
A6QHX0 4.97e-180 508 61 3 392 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain Newman)
Q5HEY9 4.97e-180 508 61 3 392 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain COL)
Q2YTK1 4.97e-180 508 61 3 392 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G1W4 4.97e-180 508 61 3 392 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFV6 4.97e-180 508 61 3 392 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain USA300)
A1KS98 7.61e-180 508 67 3 389 3 metK S-adenosylmethionine synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A8FGH7 8.66e-180 508 63 3 392 3 metK S-adenosylmethionine synthase Bacillus pumilus (strain SAFR-032)
Q12FG9 8.87e-180 508 67 4 378 3 metK S-adenosylmethionine synthase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q9K7Q9 1.49e-179 507 61 3 394 3 metK S-adenosylmethionine synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A9BXF7 1.73e-179 507 66 4 389 3 metK S-adenosylmethionine synthase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q6GFR6 2.2e-179 507 61 3 392 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain MRSA252)
P66767 2.81e-179 506 61 3 392 1 metK S-adenosylmethionine synthase Staphylococcus aureus (strain N315)
P66766 2.81e-179 506 61 3 392 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ITV6 2.81e-179 506 61 3 392 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain JH9)
A6U2Q1 2.81e-179 506 61 3 392 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain JH1)
A7X3N2 2.81e-179 506 61 3 392 3 metK S-adenosylmethionine synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2RK28 3.24e-179 506 61 2 395 3 metK S-adenosylmethionine synthase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A1VK01 3.91e-179 506 65 5 391 3 metK S-adenosylmethionine synthase Polaromonas naphthalenivorans (strain CJ2)
A9M1V8 4.63e-179 506 67 3 389 3 metK S-adenosylmethionine synthase Neisseria meningitidis serogroup C (strain 053442)
Q65FV8 5.44e-179 506 62 4 394 3 metK S-adenosylmethionine synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q9JVV6 7.09e-179 505 68 3 389 3 metK S-adenosylmethionine synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JY09 1.34e-178 504 67 3 389 3 metK S-adenosylmethionine synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B9MQ10 2.18e-178 504 63 3 390 3 metK S-adenosylmethionine synthase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B9MDD1 2.28e-178 504 66 4 389 3 metK S-adenosylmethionine synthase Acidovorax ebreus (strain TPSY)
A1TKT9 2.69e-178 504 66 4 389 3 metK S-adenosylmethionine synthase Paracidovorax citrulli (strain AAC00-1)
A4G977 2.71e-178 503 68 3 373 3 metK S-adenosylmethionine synthase Herminiimonas arsenicoxydans
A3DHM4 3.95e-178 503 61 2 394 3 metK S-adenosylmethionine synthase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A1W3X4 3.95e-178 503 66 4 389 3 metK S-adenosylmethionine synthase Acidovorax sp. (strain JS42)
Q38YF8 9.31e-178 503 62 4 387 3 metK S-adenosylmethionine synthase Latilactobacillus sakei subsp. sakei (strain 23K)
B8I4C1 1.01e-177 503 61 2 396 3 metK S-adenosylmethionine synthase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q5WDZ8 1.22e-177 503 61 3 390 3 metK S-adenosylmethionine synthase Shouchella clausii (strain KSM-K16)
Q3A388 1.22e-177 502 62 2 387 3 metK S-adenosylmethionine synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
C5CQF1 2.45e-177 501 67 4 375 3 metK S-adenosylmethionine synthase Variovorax paradoxus (strain S110)
Q8Y347 3.71e-177 501 67 3 383 3 metK S-adenosylmethionine synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8EP05 4.9e-177 501 62 3 388 3 metK S-adenosylmethionine synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q1H4X2 6.53e-177 500 67 2 377 3 metK S-adenosylmethionine synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A7GU40 9.16e-177 500 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q5P2V5 1.12e-176 499 65 2 384 3 metK S-adenosylmethionine synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B1I6C4 1.13e-176 500 61 2 391 3 metK S-adenosylmethionine synthase Desulforudis audaxviator (strain MP104C)
B9DN19 1.32e-176 499 61 3 390 3 metK S-adenosylmethionine synthase Staphylococcus carnosus (strain TM300)
Q0BAY8 1.42e-176 499 67 2 385 3 metK S-adenosylmethionine synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YPQ4 1.42e-176 499 67 2 385 3 metK S-adenosylmethionine synthase Burkholderia ambifaria (strain MC40-6)
Q18CL7 1.72e-176 499 60 3 396 3 metK S-adenosylmethionine synthase Clostridioides difficile (strain 630)
A4XHT8 2.28e-176 499 62 2 384 3 metK S-adenosylmethionine synthase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A4JIQ4 2.35e-176 499 66 2 385 3 metK S-adenosylmethionine synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
B2T1P7 2.43e-176 499 66 2 383 3 metK S-adenosylmethionine synthase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B7IL28 3.88e-176 498 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain G9842)
Q2T267 3.88e-176 498 66 2 385 3 metK S-adenosylmethionine synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q1BSN9 4.14e-176 498 67 2 385 3 metK S-adenosylmethionine synthase Burkholderia orbicola (strain AU 1054)
B1K0F2 4.14e-176 498 67 2 385 3 metK S-adenosylmethionine synthase Burkholderia orbicola (strain MC0-3)
A0KBF2 4.14e-176 498 67 2 385 3 metK S-adenosylmethionine synthase Burkholderia cenocepacia (strain HI2424)
B2JJY6 5.94e-176 498 67 2 383 3 metK S-adenosylmethionine synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q146W0 9.54e-176 498 66 2 383 3 metK S-adenosylmethionine synthase Paraburkholderia xenovorans (strain LB400)
A2RN40 1.14e-175 497 61 4 394 3 metK S-adenosylmethionine synthase Lactococcus lactis subsp. cremoris (strain MG1363)
Q632S5 1.29e-175 497 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain ZK / E33L)
B9J265 1.29e-175 497 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain Q1)
B7JT32 1.29e-175 497 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain AH820)
Q81KI0 1.29e-175 497 61 3 394 3 metK S-adenosylmethionine synthase Bacillus anthracis
C3LAZ9 1.29e-175 497 61 3 394 3 metK S-adenosylmethionine synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PCC4 1.29e-175 497 61 3 394 3 metK S-adenosylmethionine synthase Bacillus anthracis (strain A0248)
A8MJT0 1.41e-175 497 60 2 395 3 metK S-adenosylmethionine synthase Alkaliphilus oremlandii (strain OhILAs)
B4E800 1.43e-175 497 66 2 385 3 metK S-adenosylmethionine synthase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q39BZ1 1.49e-175 497 66 2 385 3 metK S-adenosylmethionine synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q816Q8 1.81e-175 497 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H9C7 1.81e-175 497 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain B4264)
A5GA66 1.82e-175 496 62 2 387 3 metK S-adenosylmethionine synthase Geotalea uraniireducens (strain Rf4)
Q6HCB4 1.83e-175 497 61 3 394 3 metK S-adenosylmethionine synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
B7HSV6 1.83e-175 497 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain AH187)
A1WSC8 2.16e-175 497 64 4 389 3 metK S-adenosylmethionine synthase Verminephrobacter eiseniae (strain EF01-2)
C1EW36 2.21e-175 497 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain 03BB102)
Q72YV6 2.21e-175 497 61 3 394 3 metK S-adenosylmethionine synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RJZ7 2.21e-175 497 61 3 394 3 metK S-adenosylmethionine synthase Bacillus thuringiensis (strain Al Hakam)
A4J945 3.4e-175 496 59 2 397 3 metK S-adenosylmethionine synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q63YH5 3.65e-175 496 66 2 385 1 metK S-adenosylmethionine synthase Burkholderia pseudomallei (strain K96243)
A3N4I1 3.65e-175 496 66 2 385 3 metK S-adenosylmethionine synthase Burkholderia pseudomallei (strain 668)
Q3JX94 3.65e-175 496 66 2 385 3 metK S-adenosylmethionine synthase Burkholderia pseudomallei (strain 1710b)
A3NQ73 3.65e-175 496 66 2 385 3 metK S-adenosylmethionine synthase Burkholderia pseudomallei (strain 1106a)
A1V7L5 3.65e-175 496 66 2 385 3 metK S-adenosylmethionine synthase Burkholderia mallei (strain SAVP1)
Q62EZ1 3.65e-175 496 66 2 385 3 metK S-adenosylmethionine synthase Burkholderia mallei (strain ATCC 23344)
A2S860 3.65e-175 496 66 2 385 3 metK S-adenosylmethionine synthase Burkholderia mallei (strain NCTC 10229)
A3MRQ4 3.65e-175 496 66 2 385 3 metK S-adenosylmethionine synthase Burkholderia mallei (strain NCTC 10247)
A9VLC6 3.81e-175 496 61 3 394 3 metK S-adenosylmethionine synthase Bacillus mycoides (strain KBAB4)
B2UD22 4.17e-175 496 67 3 383 3 metK S-adenosylmethionine synthase Ralstonia pickettii (strain 12J)
Q02WN8 8.94e-175 495 62 4 390 3 metK S-adenosylmethionine synthase Lactococcus lactis subsp. cremoris (strain SK11)
Q7VFY5 2.17e-174 494 62 2 384 3 metK S-adenosylmethionine synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A4T0F0 2.48e-174 493 66 2 384 3 metK S-adenosylmethionine synthase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
C6E2L2 3.34e-174 493 61 2 387 3 metK S-adenosylmethionine synthase Geobacter sp. (strain M21)
A0LCX5 3.98e-174 493 62 3 386 3 metK S-adenosylmethionine synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
P61946 4.59e-174 493 61 2 387 3 metK S-adenosylmethionine synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A5UQL0 4.73e-174 493 61 3 394 3 metK S-adenosylmethionine synthase Roseiflexus sp. (strain RS-1)
Q7M7Z2 6.98e-174 492 60 2 382 3 metK S-adenosylmethionine synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q39W48 1.2e-173 492 60 2 387 3 metK S-adenosylmethionine synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q0AXL1 1.4e-173 492 59 2 396 3 metK S-adenosylmethionine synthase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B0KC73 1.55e-173 492 59 2 393 3 metK S-adenosylmethionine synthase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q9CEE0 1.91e-173 492 61 4 394 3 metK S-adenosylmethionine synthase Lactococcus lactis subsp. lactis (strain IL1403)
Q49YL6 2.56e-173 491 60 4 389 3 metK S-adenosylmethionine synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B1XSH9 2.97e-173 491 65 2 384 3 metK S-adenosylmethionine synthase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q837P9 4.1e-173 491 61 3 385 3 metK S-adenosylmethionine synthase Enterococcus faecalis (strain ATCC 700802 / V583)
Q67T90 8.25e-173 490 61 2 391 3 metK S-adenosylmethionine synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A7NFR6 1.36e-172 490 61 3 394 3 metK S-adenosylmethionine synthase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A8YWU7 1.86e-172 489 61 4 393 3 metK S-adenosylmethionine synthase Lactobacillus helveticus (strain DPC 4571)
B9K7H2 1.9e-172 489 59 3 393 3 metK S-adenosylmethionine synthase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
B4ULF7 7.81e-172 487 64 3 385 3 metK S-adenosylmethionine synthase Anaeromyxobacter sp. (strain K)
B8J8T3 8.86e-172 487 64 3 385 3 metK S-adenosylmethionine synthase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q03QA4 9.07e-172 487 63 5 390 3 metK S-adenosylmethionine synthase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q4L7C7 1.7e-171 487 59 3 392 3 metK S-adenosylmethionine synthase Staphylococcus haemolyticus (strain JCSC1435)
Q98A80 2.13e-171 486 63 2 382 3 metK S-adenosylmethionine synthase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q92AZ5 7.07e-171 485 61 6 393 3 metK S-adenosylmethionine synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q5FIN8 2.04e-170 484 60 4 393 3 metK S-adenosylmethionine synthase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B8DFQ7 2.33e-170 484 61 6 393 3 metK S-adenosylmethionine synthase Listeria monocytogenes serotype 4a (strain HCC23)
Q71Z03 2.33e-170 484 61 6 393 3 metK S-adenosylmethionine synthase Listeria monocytogenes serotype 4b (strain F2365)
C1KVW3 2.33e-170 484 61 6 393 3 metK S-adenosylmethionine synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
B9LBJ9 4.29e-170 483 61 3 391 3 metK S-adenosylmethionine synthase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WGQ3 4.29e-170 483 61 3 391 3 metK S-adenosylmethionine synthase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q2IM98 4.79e-170 483 63 3 385 3 metK S-adenosylmethionine synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
A0AJB9 4.95e-170 483 61 6 393 3 metK S-adenosylmethionine synthase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A0LF65 5.21e-170 483 60 2 387 3 metK S-adenosylmethionine synthase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B1LB17 1.19e-169 482 58 3 393 3 metK S-adenosylmethionine synthase Thermotoga sp. (strain RQ2)
A5ILS4 1.19e-169 482 58 3 393 3 metK S-adenosylmethionine synthase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9X1Y8 1.19e-169 482 58 3 393 3 metK S-adenosylmethionine synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q8Y6M0 1.74e-169 482 61 6 393 3 metK S-adenosylmethionine synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8RCE4 4.87e-169 480 58 2 393 3 metK S-adenosylmethionine synthase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A3CNY4 5.1e-169 480 60 4 389 3 metK S-adenosylmethionine synthase Streptococcus sanguinis (strain SK36)
A8ZYC8 5.89e-169 480 62 2 385 3 metK S-adenosylmethionine synthase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q9L0Y3 1.67e-168 479 58 4 402 3 metK S-adenosylmethionine synthase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q74KS4 1.78e-168 479 60 3 389 3 metK S-adenosylmethionine synthase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A8AWW6 1.79e-168 479 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B5Z9W8 4.57e-168 478 60 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain G27)
B6JPU7 4.67e-168 478 60 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain P12)
Q9ZMN5 7.55e-168 477 60 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain J99 / ATCC 700824)
Q8CNT5 1.26e-167 477 58 3 396 3 metK S-adenosylmethionine synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNB8 1.26e-167 477 58 3 396 3 metK S-adenosylmethionine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B2US27 2.06e-167 476 60 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain Shi470)
A7HJA9 2.12e-167 476 58 3 394 3 metK S-adenosylmethionine synthase Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q8DT23 2.27e-167 476 60 3 389 3 metK S-adenosylmethionine synthase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A7H6N1 2.54e-167 476 62 3 383 3 metK S-adenosylmethionine synthase Anaeromyxobacter sp. (strain Fw109-5)
P56460 2.68e-167 476 60 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q1CUW4 5.23e-167 475 60 2 378 3 metK S-adenosylmethionine synthase Helicobacter pylori (strain HPAG1)
Q5SHT8 6.1e-167 475 58 3 393 3 metK S-adenosylmethionine synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72I53 6.1e-167 475 58 3 393 1 metK S-adenosylmethionine synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A9EXT3 7.46e-167 476 60 1 379 3 metK S-adenosylmethionine synthase Sorangium cellulosum (strain So ce56)
Q0SR05 1.62e-166 474 60 2 386 3 metK S-adenosylmethionine synthase Clostridium perfringens (strain SM101 / Type A)
Q0TND4 1.62e-166 474 60 2 386 3 metK S-adenosylmethionine synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8E5Y0 3.13e-166 473 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus agalactiae serotype III (strain NEM316)
Q8DQH0 4.88e-166 473 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2INE5 4.88e-166 473 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain CGSP14)
B1IAT8 4.88e-166 473 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain Hungary19A-6)
B5E364 4.88e-166 473 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae serotype 19F (strain G54)
Q04LE0 4.88e-166 473 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
C6C1U5 5.78e-166 473 60 1 382 3 metK S-adenosylmethionine synthase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q17YQ7 6.46e-166 472 60 2 378 3 metK S-adenosylmethionine synthase Helicobacter acinonychis (strain Sheeba)
B8ZNB7 8.34e-166 472 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B9DSM6 9.69e-166 472 59 3 390 3 metK S-adenosylmethionine synthase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
C1C6A5 1e-165 472 59 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain 70585)
A6Q1Z8 1.01e-165 472 59 2 377 3 metK S-adenosylmethionine synthase Nitratiruptor sp. (strain SB155-2)
A4VWU8 1.35e-165 472 60 5 390 3 metK S-adenosylmethionine synthase Streptococcus suis (strain 05ZYH33)
A4W351 1.35e-165 472 60 5 390 3 metK S-adenosylmethionine synthase Streptococcus suis (strain 98HAH33)
Q88XB8 1.59e-165 471 62 4 387 1 metK S-adenosylmethionine synthase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
C4XPZ6 1.86e-165 471 61 1 379 3 metK S-adenosylmethionine synthase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
C0ZZD4 2.01e-165 471 59 3 399 3 metK S-adenosylmethionine synthase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q8E0A3 2.26e-165 471 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3K1M7 2.26e-165 471 60 4 388 3 metK S-adenosylmethionine synthase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
C1CJL0 2.41e-165 471 58 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain P1031)
Q03GG8 3.2e-165 471 62 4 388 3 metK S-adenosylmethionine synthase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B1W470 3.24e-165 471 58 4 402 3 metK S-adenosylmethionine synthase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
A9BHX2 3.81e-165 471 57 5 401 3 metK S-adenosylmethionine synthase Petrotoga mobilis (strain DSM 10674 / SJ95)
C1CQM2 5.34e-165 470 58 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain Taiwan19F-14)
Q97RN9 5.34e-165 470 58 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B2G8G3 7.01e-165 470 60 5 391 3 metK S-adenosylmethionine synthase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VL29 7.01e-165 470 60 5 391 3 metK S-adenosylmethionine synthase Limosilactobacillus reuteri (strain DSM 20016)
A1SJF9 1.4e-164 469 61 5 385 3 metK S-adenosylmethionine synthase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q311V1 2.05e-164 469 60 3 380 3 metK S-adenosylmethionine synthase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q827Q0 2.47e-164 469 57 4 402 3 metK S-adenosylmethionine synthase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q47R14 5.43e-164 468 59 4 396 3 metK S-adenosylmethionine synthase Thermobifida fusca (strain YX)
B7IEV2 6.03e-164 468 57 4 389 3 metK S-adenosylmethionine synthase Thermosipho africanus (strain TCF52B)
Q898W7 6.82e-164 467 59 2 386 3 metK S-adenosylmethionine synthase Clostridium tetani (strain Massachusetts / E88)
C1CDB0 8.3e-164 467 58 4 389 3 metK S-adenosylmethionine synthase Streptococcus pneumoniae (strain JJA)
B2GDG2 1.88e-163 466 61 5 391 3 metK S-adenosylmethionine synthase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q48SU7 1.91e-163 466 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q6MPK2 2.92e-163 466 61 1 382 3 metK S-adenosylmethionine synthase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q5XBJ6 1.01e-162 464 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A6LNU4 1.31e-162 464 56 3 390 3 metK S-adenosylmethionine synthase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q1CY83 1.36e-162 464 62 4 380 3 metK S-adenosylmethionine synthase Myxococcus xanthus (strain DK1622)
Q03AU4 1.58e-162 464 59 6 386 3 metK S-adenosylmethionine synthase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WCC9 1.58e-162 464 59 6 386 3 metK S-adenosylmethionine synthase Lacticaseibacillus casei (strain BL23)
B5XM14 1.74e-162 464 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M49 (strain NZ131)
A2RE06 1.74e-162 464 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JL80 1.74e-162 464 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JB36 1.74e-162 464 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8P0G6 1.74e-162 464 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q1J626 2.21e-162 464 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M4 (strain MGAS10750)
B7KFF5 3.6e-162 464 57 6 405 3 metK S-adenosylmethionine synthase Gloeothece citriformis (strain PCC 7424)
Q73JR4 4.09e-162 462 60 2 382 3 metK S-adenosylmethionine synthase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q5YTN0 4.36e-162 463 58 4 399 3 metK S-adenosylmethionine synthase Nocardia farcinica (strain IFM 10152)
P0DF55 4.7e-162 463 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DF54 4.7e-162 463 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q5M434 4.9e-162 462 58 3 389 3 metK S-adenosylmethionine synthase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q99Z77 7.77e-162 462 58 3 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M1
A5CRX0 8.85e-162 462 59 3 398 3 metK S-adenosylmethionine synthase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
B1KST9 9.11e-162 462 60 2 385 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Loch Maree / Type A3)
Q1JGA1 9.56e-162 462 59 3 388 3 metK S-adenosylmethionine synthase Streptococcus pyogenes serotype M2 (strain MGAS10270)
A0Q2Y4 1.15e-161 461 58 2 386 3 metK S-adenosylmethionine synthase Clostridium novyi (strain NT)
Q0S0L4 1.34e-161 462 58 3 399 3 metK S-adenosylmethionine synthase Rhodococcus jostii (strain RHA1)
C1B4J7 1.51e-161 462 58 3 399 3 metK S-adenosylmethionine synthase Rhodococcus opacus (strain B4)
A7G9S1 1.92e-161 461 59 2 385 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5HY62 2.09e-161 461 59 2 385 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FQI8 2.09e-161 461 59 2 385 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain ATCC 19397 / Type A)
Q5LZI0 2.34e-161 461 58 3 389 3 metK S-adenosylmethionine synthase Streptococcus thermophilus (strain CNRZ 1066)
C1FQQ5 2.87e-161 461 59 2 385 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Kyoto / Type A2)
Q84FD3 4.49e-161 460 61 4 380 3 metK S-adenosylmethionine synthase Myxococcus xanthus
B0REV4 4.51e-161 461 58 3 398 3 metK S-adenosylmethionine synthase Clavibacter sepedonicus
Q30PN0 5.25e-161 460 57 2 380 3 metK S-adenosylmethionine synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B1IE45 6.44e-161 459 59 2 385 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Okra / Type B1)
Q1WUT4 1.08e-160 459 62 4 387 3 metK S-adenosylmethionine synthase Ligilactobacillus salivarius (strain UCC118)
Q97F85 1.14e-160 459 59 2 385 3 metK S-adenosylmethionine synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q938W7 1.37e-160 459 57 4 407 3 metK S-adenosylmethionine synthase Streptomyces fradiae
Q9X4Q2 2.33e-160 459 57 4 394 3 metK S-adenosylmethionine synthase Streptomyces spectabilis
C0M9M7 2.55e-160 459 58 3 388 3 metK S-adenosylmethionine synthase Streptococcus equi subsp. equi (strain 4047)
Q1J1P4 3.63e-160 458 56 3 398 3 metK S-adenosylmethionine synthase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
C1CY25 6e-160 457 56 4 398 3 metK S-adenosylmethionine synthase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
C0MCM1 6.52e-160 457 58 3 388 3 metK S-adenosylmethionine synthase Streptococcus equi subsp. zooepidemicus (strain H70)
A1VBJ1 7.21e-160 457 59 3 382 3 metK S-adenosylmethionine synthase Nitratidesulfovibrio vulgaris (strain DP4)
Q729A3 7.21e-160 457 59 3 382 1 metK S-adenosylmethionine synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B4U228 8.76e-160 457 58 3 388 3 metK S-adenosylmethionine synthase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q8DK88 1.06e-159 457 56 5 407 3 metK S-adenosylmethionine synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A8F5B8 1.5e-159 456 56 3 390 3 metK S-adenosylmethionine synthase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
A8LE19 1.64e-159 456 58 4 392 3 metK S-adenosylmethionine synthase Parafrankia sp. (strain EAN1pec)
Q3ZZN7 3.18e-159 456 54 2 388 3 metK S-adenosylmethionine synthase Dehalococcoides mccartyi (strain CBDB1)
Q3Z943 3.43e-159 456 54 2 388 3 metK S-adenosylmethionine synthase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
B2TK10 1.11e-158 454 58 2 386 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Eklund 17B / Type B)
Q8CXS7 1.26e-158 454 62 4 380 3 metK S-adenosylmethionine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72SM5 1.26e-158 454 62 4 380 3 metK S-adenosylmethionine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A5FRV2 1.29e-158 454 54 2 388 3 metK S-adenosylmethionine synthase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
B8DSC3 2.61e-158 453 59 1 382 3 metK S-adenosylmethionine synthase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q10VU5 2.83e-158 454 54 5 408 3 metK S-adenosylmethionine synthase Trichodesmium erythraeum (strain IMS101)
A4SF76 3.17e-158 453 59 5 400 3 metK S-adenosylmethionine synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B2UZL0 5.16e-158 452 58 2 386 3 metK S-adenosylmethionine synthase Clostridium botulinum (strain Alaska E43 / Type E3)
B1VDN7 5.32e-158 452 57 4 399 3 metK S-adenosylmethionine synthase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q8KEG7 7.51e-158 452 59 6 401 3 metK S-adenosylmethionine synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q9RWM6 8.35e-158 452 56 4 398 3 metK S-adenosylmethionine synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A4X626 9.56e-158 452 57 6 400 3 metK S-adenosylmethionine synthase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
B0S2I6 1.25e-157 451 55 2 389 3 metK S-adenosylmethionine synthase Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A6QBY6 1.34e-157 451 57 3 383 3 metK S-adenosylmethionine synthase Sulfurovum sp. (strain NBC37-1)
C0QXK7 1.45e-157 451 57 2 390 3 metK S-adenosylmethionine synthase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
B8HWM0 2e-157 452 55 5 406 3 metK S-adenosylmethionine synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A8LY25 4.09e-157 450 57 6 400 3 metK S-adenosylmethionine synthase Salinispora arenicola (strain CNS-205)
B3QMF6 4.13e-157 451 59 6 401 3 metK S-adenosylmethionine synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q2J843 1.11e-156 449 57 4 395 3 metK2 S-adenosylmethionine synthase 2 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
C5CD66 1.12e-156 449 55 2 394 3 metK S-adenosylmethionine synthase Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
B7JX26 1.94e-156 449 55 6 406 3 metK S-adenosylmethionine synthase Rippkaea orientalis (strain PCC 8801 / RF-1)
C3PG24 2.87e-156 448 57 5 400 3 metK S-adenosylmethionine synthase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q7U4S6 7.99e-156 448 57 8 396 3 metK S-adenosylmethionine synthase Parasynechococcus marenigrum (strain WH8102)
A5GJ24 9.21e-156 447 57 7 399 3 metK S-adenosylmethionine synthase Synechococcus sp. (strain WH7803)
B3EDY2 1.27e-155 447 58 5 400 3 metK S-adenosylmethionine synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
B2IUI4 3.26e-155 446 55 5 407 3 metK S-adenosylmethionine synthase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q6AF79 1.34e-154 444 57 3 392 3 metK S-adenosylmethionine synthase Leifsonia xyli subsp. xyli (strain CTCB07)
Q050E4 1.4e-154 443 60 4 380 3 metK S-adenosylmethionine synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04SB8 1.4e-154 443 60 4 380 3 metK S-adenosylmethionine synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q0ICR7 2.16e-154 444 55 8 408 3 metK S-adenosylmethionine synthase Synechococcus sp. (strain CC9311)
A9BDW6 2.32e-154 444 55 9 405 3 metK S-adenosylmethionine synthase Prochlorococcus marinus (strain MIT 9211)
Q4JVH7 2.43e-154 444 57 5 403 3 metK S-adenosylmethionine synthase Corynebacterium jeikeium (strain K411)
Q3AWE6 4.51e-154 443 55 8 408 3 metK S-adenosylmethionine synthase Synechococcus sp. (strain CC9902)
B1XPB0 5.33e-154 443 54 6 404 3 metK S-adenosylmethionine synthase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q3AME2 6.63e-154 442 55 8 409 3 metK S-adenosylmethionine synthase Synechococcus sp. (strain CC9605)
B0CG96 8.44e-154 442 56 8 406 3 metK S-adenosylmethionine synthase Acaryochloris marina (strain MBIC 11017)
Q7VDM7 9.29e-154 442 55 9 405 3 metK S-adenosylmethionine synthase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q3B531 1.18e-153 442 58 5 400 3 metK S-adenosylmethionine synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q31KC6 2.35e-153 441 53 5 407 3 metK S-adenosylmethionine synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08965
Feature type CDS
Gene metK
Product methionine adenosyltransferase
Location 1862745 - 1863899 (strand: 1)
Length 1155 (nucleotides) / 384 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_880
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00438 S-adenosylmethionine synthetase, N-terminal domain
PF02772 S-adenosylmethionine synthetase, central domain
PF02773 S-adenosylmethionine synthetase, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0192 Coenzyme transport and metabolism (H) H S-adenosylmethionine synthetase

Kegg Ortholog Annotation(s)

Protein Sequence

MSTHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTKAWVDIEEITRRTVREIGYTSSSMGFDADSCAVISAIGKQSADINQGVDREDPASQGAGDQGLMFGYASNETDVLMPAPITYAHRLVERQAKVRKSGILPWLRPDAKSQITFQYDNNNIVGIDAVVLSTQHSEDVTQKDLHEAVMEEIIKPVLPVEWLNPTTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTGKISNEQLTLLVREFFDLRPYGLIQMLDLLHPMYQETAAYGHFGRPQFPWEKTDRAEQLRDAAGLK

Flanking regions ( +/- flanking 50bp)

AGTTAATACATCCATCAATGTACCGAAAGTTTACTTAAGGTAGAAAAATAATGAGCACACATCTTTTCACTTCTGAGTCCGTATCTGAAGGACACCCGGATAAAATTGCCGACCAAATTTCGGATGCAGTCCTTGATGCGATTTTAGAACAAGATCCCAAAGCGCGTGTTGCCTGTGAAACCTATGTCAAAACCGGCATGGTCATGGTGGGCGGAGAAATCACCACCAAAGCCTGGGTTGATATTGAAGAAATAACACGCCGCACTGTCCGCGAAATTGGTTACACCAGCTCATCAATGGGCTTTGATGCTGATTCCTGCGCCGTCATCAGCGCCATCGGTAAACAGTCTGCTGATATCAATCAGGGCGTTGACCGCGAAGATCCGGCCTCACAGGGTGCGGGCGACCAGGGCTTAATGTTCGGTTATGCATCAAACGAAACTGACGTATTAATGCCCGCGCCAATCACTTACGCACACCGTCTGGTTGAGCGTCAGGCCAAAGTCCGTAAAAGCGGCATCCTTCCGTGGCTGCGCCCGGATGCAAAAAGCCAGATTACATTCCAGTATGATAACAACAACATTGTCGGTATCGATGCGGTTGTTCTGTCAACACAGCACTCTGAAGACGTTACTCAGAAAGACCTGCATGAAGCGGTAATGGAAGAGATAATCAAACCGGTTCTGCCGGTTGAGTGGCTGAACCCGACCACCAAATACTTCATTAACCCGACCGGTCGCTTTGTGATTGGCGGACCAATGGGTGACTGTGGTCTGACCGGACGTAAAATTATCGTCGATACTTACGGCGGCATGGCTCGTCACGGCGGTGGTGCATTCTCAGGTAAAGATCCGTCTAAGGTTGACCGTTCAGCGGCTTATGCTGCGCGTTATGTGGCAAAAAATATTGTCGCCGCCGGTCTTGCTGACCGCTGTGAAATCCAGGTTTCCTATGCGATTGGTGTGGCTGAGCCAACTTCAATCATGGTGGAAACCTTCGGCACAGGAAAAATCAGCAATGAACAACTGACGCTGCTGGTGCGTGAATTCTTTGACCTGCGCCCGTATGGTCTGATCCAGATGCTGGATCTGCTGCATCCGATGTATCAGGAAACGGCTGCATACGGTCACTTCGGCCGCCCTCAGTTCCCGTGGGAAAAAACCGACAGAGCAGAACAGTTGCGTGATGCTGCCGGTCTGAAATAAAACTGCGCACCACACTTACTGCTTAACGACAAAAACCGGCCTTCGTGCCG