Homologs in group_285

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09300 FBDBKF_09300 27.0 Morganella morganii S1 sctT type III secretion system export apparatus subunit SctT
EHELCC_10110 EHELCC_10110 27.0 Morganella morganii S2 sctT type III secretion system export apparatus subunit SctT
NLDBIP_10455 NLDBIP_10455 27.0 Morganella morganii S4 sctT type III secretion system export apparatus subunit SctT
LHKJJB_10900 LHKJJB_10900 27.0 Morganella morganii S3 sctT type III secretion system export apparatus subunit SctT
HKOGLL_13960 HKOGLL_13960 27.0 Morganella morganii S5 sctT type III secretion system export apparatus subunit SctT
F4V73_RS10665 F4V73_RS10665 24.9 Morganella psychrotolerans sctT type III secretion system export apparatus subunit SctT
PMI_RS13235 PMI_RS13235 26.2 Proteus mirabilis HI4320 sctT type III secretion system export apparatus subunit SctT

Distribution of the homologs in the orthogroup group_285

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_285

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P69985 3.37e-36 132 36 3 215 3 yscT Yop proteins translocation protein T Yersinia pseudotuberculosis serotype I (strain IP32953)
P69984 3.37e-36 132 36 3 215 3 yscT Yop proteins translocation protein T Yersinia pestis
P96068 5.47e-20 89 30 8 231 3 ssaT Secretion system apparatus protein SsaT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1M7 3.17e-16 79 32 8 214 3 spaR Surface presentation of antigens protein SpaR Shigella sonnei
P0A1M6 5.14e-16 78 32 8 214 1 spaR Surface presentation of antigens protein SpaR Shigella flexneri
P55722 6.11e-14 73 30 7 210 3 NGR_a00590 Probable translocation protein y4yN Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P35537 1.21e-11 66 28 6 230 3 fliR Flagellar biosynthetic protein FliR Bacillus subtilis (strain 168)
P40701 3.63e-10 62 24 3 222 1 spaR Surface presentation of antigens protein SpaR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P34202 4.85e-07 53 25 3 200 3 fliR Flagellar biosynthetic protein FliR Pectobacterium carotovorum subsp. carotovorum
P57186 6.51e-05 46 23 6 219 3 fliR Flagellar biosynthetic protein FliR Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O67773 0.000188 45 29 3 151 3 fliR Flagellar biosynthetic protein FliR Aquifex aeolicus (strain VF5)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08345
Feature type CDS
Gene sctT
Product type III secretion system export apparatus subunit SctT
Location 1728193 - 1728978 (strand: 1)
Length 786 (nucleotides) / 261 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_285
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01311 Bacterial export proteins, family 1

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4791 Intracellular trafficking, secretion, and vesicular transport (U) U Type III secretory pathway, EscT/YscT component

Protein Sequence

MMVFTDLIYPFFTSLFLALPRLYGFFLLLPMMNKSLFGHRLINHAIVLSLGFLIRQHLPTPLPEMSTWFFFFIIIKEFFTGLLFGVIAVIPFWAMEAAGQCIDQQRGATTGNILNPLSGQQASLTGIFFSQYLILFYLTSGLFFQLIALFLRGFIWFPVFNSQFIFPATLISLFFELITLYSHAVVNFALPLIIPMYLTEIALAFVNKFAPALNVFVIAMPVKSAVALFFATGYVMIANDPLTTLIKQTFTLISTLNIPLL

Flanking regions ( +/- flanking 50bp)

TGGTCAGGGCAGCAATTGCTGATATTTTTTAATCAGATATTTGCACTGCTATGATGGTATTCACTGACCTTATATATCCGTTTTTTACTTCACTTTTTCTGGCGCTGCCCAGGCTGTATGGTTTTTTTTTACTACTGCCGATGATGAATAAGTCACTGTTCGGACACCGCCTCATCAATCATGCCATTGTATTATCACTGGGATTTCTTATCAGGCAGCACCTGCCAACACCCTTACCAGAGATGAGCACATGGTTCTTTTTCTTTATTATTATCAAAGAGTTTTTTACCGGATTACTATTTGGTGTCATTGCTGTCATTCCCTTTTGGGCAATGGAAGCTGCCGGACAATGTATTGATCAGCAACGCGGGGCAACCACAGGAAATATACTCAATCCGCTTTCCGGTCAGCAGGCATCGCTGACCGGCATTTTTTTCTCTCAGTATCTGATCCTGTTTTATCTGACGTCCGGCTTATTCTTTCAGCTAATTGCTTTATTTTTACGCGGATTTATCTGGTTCCCGGTTTTCAATTCACAATTTATATTTCCGGCCACGCTTATTTCCTTATTTTTTGAATTAATCACACTGTACAGCCACGCTGTTGTAAATTTTGCTCTTCCGCTGATCATTCCCATGTATCTGACTGAAATTGCGCTGGCTTTCGTCAATAAGTTTGCACCTGCATTAAATGTTTTTGTAATTGCAATGCCGGTAAAATCCGCTGTCGCACTTTTTTTTGCAACCGGCTATGTCATGATAGCGAATGACCCGCTGACAACGTTGATAAAACAAACATTCACACTCATTTCTACTCTCAACATTCCACTATTATGAATTCAGAAAAATAATGAGCGGAGAAAAAACTGAACAGCCCACCACTAAAA