Homologs in group_1667

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11590 FBDBKF_11590 96.4 Morganella morganii S1 crr PTS glucose transporter subunit IIA
EHELCC_17510 EHELCC_17510 96.4 Morganella morganii S2 crr PTS glucose transporter subunit IIA
NLDBIP_18720 NLDBIP_18720 96.4 Morganella morganii S4 crr PTS glucose transporter subunit IIA
LHKJJB_17950 LHKJJB_17950 96.4 Morganella morganii S3 crr PTS glucose transporter subunit IIA
HKOGLL_18700 HKOGLL_18700 96.4 Morganella morganii S5 crr PTS glucose transporter subunit IIA
PMI_RS09030 PMI_RS09030 87.6 Proteus mirabilis HI4320 crr PTS glucose transporter subunit IIA

Distribution of the homologs in the orthogroup group_1667

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1667

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A283 4.48e-106 303 91 0 169 1 crr PTS system glucose-specific EIIA component Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A284 4.48e-106 303 91 0 169 1 crr PTS system glucose-specific EIIA component Salmonella typhi
P69785 6.73e-106 303 90 0 169 3 crr PTS system glucose-specific EIIA component Shigella flexneri
P69783 6.73e-106 303 90 0 169 1 crr PTS system glucose-specific EIIA component Escherichia coli (strain K12)
P69784 6.73e-106 303 90 0 169 3 crr PTS system glucose-specific EIIA component Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45338 4.7e-80 237 71 1 169 1 crr PTS system glucose-specific EIIA component Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8KA51 7.89e-65 199 63 0 147 3 crr PTS system glucose-specific EIIA component Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9WXI7 1.85e-61 190 61 0 151 3 crr PTS system glucose-specific EIIA component Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89B05 1.28e-58 183 61 0 149 3 crr PTS system glucose-specific EIIA component Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q44840 3.91e-52 167 54 0 135 3 crr PTS system glucose-specific EIIA component Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q81JY0 1.34e-43 145 46 3 167 3 crr PTS system glucose-specific EIIA component Bacillus anthracis
Q814U8 1.61e-43 144 45 2 166 3 crr PTS system glucose-specific EIIA component Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8CZD5 1.86e-43 144 41 2 163 3 crr PTS system glucose-specific EIIA component Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P45604 4.42e-43 154 50 2 154 3 nagE PTS system N-acetylglucosamine-specific EIICBA component Klebsiella pneumoniae
Q9KCQ4 5.46e-43 143 44 2 170 3 crr PTS system glucose-specific EIIA component Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P09323 8.26e-43 153 48 1 149 1 nagE PTS system N-acetylglucosamine-specific EIICBA component Escherichia coli (strain K12)
Q8CP79 6.89e-39 133 39 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPB5 6.89e-39 133 39 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P60857 1.49e-38 132 40 1 162 1 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain N315)
P60856 1.49e-38 132 40 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q93P61 1.68e-38 132 40 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus
Q5HFZ9 1.68e-38 132 40 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain COL)
Q6GGY5 1.81e-38 132 40 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain MRSA252)
Q8NWR1 9.16e-38 130 39 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain MW2)
Q6G9D9 9.16e-38 130 39 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain MSSA476)
Q7A807 4.09e-36 135 46 2 143 1 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain N315)
Q99X32 4.09e-36 135 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IP58 4.09e-36 135 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain JH9)
A6TXX3 4.09e-36 135 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain JH1)
A7WXI2 4.09e-36 135 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2YUZ1 6.97e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8NYM1 7.93e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MW2)
A8Z0F5 7.93e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain USA300 / TCH1516)
Q6GCT7 7.93e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MSSA476)
A6QDH3 7.93e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Newman)
Q5HJI3 7.93e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain COL)
Q2G1G8 7.93e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK73 7.93e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain USA300)
Q6GKB7 8.25e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MRSA252)
Q4A0C4 9.37e-36 134 44 1 147 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P42015 2.39e-35 128 42 1 147 3 ptsG PTS system glucose-specific EIICBA component (Fragment) Geobacillus stearothermophilus
P50829 4.99e-35 123 44 0 129 4 ptsA Phosphotransferase enzyme IIA component PtsA Bacillus subtilis (strain 168)
Q7CCJ4 1.08e-33 128 47 1 139 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HL73 1.08e-33 128 47 1 139 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8VRH0 1.08e-33 128 47 1 139 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis
P20166 1.09e-33 128 45 1 148 1 ptsG PTS system glucose-specific EIICBA component Bacillus subtilis (strain 168)
Q57071 1.34e-33 128 44 0 143 1 ptsG PTS system glucose-specific EIICBA component Staphylococcus carnosus (strain TM300)
Q53922 5.57e-33 126 44 0 143 1 glcB PTS system glucoside-specific EIICBA component Staphylococcus carnosus (strain TM300)
Q45298 2.05e-32 124 41 0 148 3 ptsG PTS system glucose-specific EIIBCA component Corynebacterium glutamicum
P39816 3.42e-32 124 47 0 124 2 gamP PTS system glucosamine-specific EIICBA component Bacillus subtilis (strain 168)
A5IVW5 3.8e-32 124 45 1 133 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain JH9)
A6U4R9 3.8e-32 124 45 1 133 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain JH1)
Q4L945 4.33e-32 124 48 0 122 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus haemolyticus (strain JCSC1435)
Q6GDR0 6.31e-32 123 45 1 133 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MRSA252)
Q8NUS2 8.06e-32 123 45 1 133 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MW2)
A8Z3D6 8.06e-32 123 45 1 133 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6D6 8.06e-32 123 45 1 133 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MSSA476)
A6QK27 8.06e-32 123 45 1 133 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Newman)
Q5HD13 8.06e-32 123 45 1 133 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain COL)
Q2FV87 8.06e-32 123 45 1 133 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FDW8 8.06e-32 123 45 1 133 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain USA300)
Q2YWC1 1.48e-31 122 45 1 133 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A3G4 2.41e-31 121 45 1 133 1 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain N315)
Q99R97 2.41e-31 121 45 1 133 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X6P1 2.41e-31 121 45 1 133 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q46072 1.98e-30 119 39 0 148 4 ptsM PTS system mannose-specific EIIBCA component Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P12655 6.65e-30 117 39 2 149 1 scrA PTS system sucrose-specific EIIBCA component Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P45618 4.48e-29 107 38 2 147 1 crr PTS system glucose-specific EIIA component Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
P35595 5.41e-29 115 41 2 148 3 exp5 PTS system glucose-specific EIICBA component Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P26207 6.34e-29 114 37 1 143 3 arbF PTS system beta-glucoside-specific EIIBCA component Dickeya chrysanthemi
P08722 1.77e-27 110 38 1 147 1 bglF PTS system beta-glucoside-specific EIIBCA component Escherichia coli (strain K12)
Q9KF90 1.3e-25 105 34 0 129 3 bglP PTS system beta-glucoside-specific EIIBCA component Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P43466 5.44e-25 103 43 0 104 3 rafP Raffinose carrier protein Pediococcus pentosaceus
P40739 6.58e-25 103 38 1 129 3 bglP PTS system beta-glucoside-specific EIIBCA component Bacillus subtilis (strain 168)
P23936 1.39e-22 96 35 0 139 3 lacS Lactose permease Streptococcus thermophilus
P43470 5.32e-22 95 34 2 144 3 scrA PTS system sucrose-specific EIIBCA component Pediococcus pentosaceus
Q7WTB2 4.14e-21 92 45 2 110 2 lacS Lactose permease Lactobacillus helveticus
P22733 9.46e-21 91 36 1 125 3 lacY Lactose permease Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q48624 7.26e-13 68 33 1 110 3 lacS Lactose permease Leuconostoc lactis
P47315 7.16e-11 63 31 7 163 3 ptsG PTS system glucose-specific EIICBA component Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75569 1.16e-09 59 28 7 163 3 ptsG PTS system glucose-specific EIICBA component Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
O32292 1.89e-09 54 42 0 63 3 yyzE Putative phosphotransferase enzyme IIA component YyzE Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08090
Feature type CDS
Gene crr
Product PTS glucose transporter subunit IIA
Location 1680218 - 1680727 (strand: 1)
Length 510 (nucleotides) / 169 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1667
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00358 phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2190 Carbohydrate transport and metabolism (G) G Phosphotransferase system IIA component

Kegg Ortholog Annotation(s)

Protein Sequence

MGLFDKLKSLVSDDKKDSGTIEIVAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPTGNKIVAPVDGTIGKIFETNHAFSIESDSGIELFVHFGIDTVELKGEGFKRIAEEGQRVQKGDLVLEFDLALLEEKAKSTLTPVVISNMDEIKEMVKMTGSVTVGETVIIKIKK

Flanking regions ( +/- flanking 50bp)

ACTAAGCCAAATTCACGCCCGGTCCCGTATCAACACTTAGGAGAGTATTCATGGGTCTGTTTGACAAACTGAAATCATTGGTTTCAGACGATAAAAAAGACAGCGGCACGATTGAGATCGTCGCCCCGCTTTCTGGTGAGATTGTGAATATCGAAGATGTGCCTGACGTTGTTTTTGCTGAAAAAATTGTTGGTGATGGTATTGCCATCAAACCTACGGGTAACAAGATTGTCGCACCGGTTGACGGTACTATCGGCAAGATTTTTGAAACCAATCACGCGTTCTCTATTGAGTCGGACAGCGGGATTGAACTGTTTGTTCACTTTGGTATCGACACCGTTGAGCTCAAAGGTGAAGGCTTCAAACGTATTGCGGAAGAAGGCCAGCGTGTACAGAAAGGTGATTTAGTGCTTGAGTTTGACCTGGCACTGCTGGAAGAAAAAGCTAAATCCACACTGACACCGGTGGTTATTTCCAATATGGATGAAATAAAAGAGATGGTCAAAATGACCGGCTCTGTCACTGTCGGTGAGACGGTGATTATTAAAATCAAAAAATAAGCCGATTCTGACCTGCGTCTGAATCCGGTAAAAGAGCGGCTTTCTGAGGA