Homologs in group_339

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11600 FBDBKF_11600 98.8 Morganella morganii S1 ptsH phosphocarrier protein Hpr
EHELCC_17520 EHELCC_17520 98.8 Morganella morganii S2 ptsH phosphocarrier protein Hpr
NLDBIP_18730 NLDBIP_18730 98.8 Morganella morganii S4 ptsH phosphocarrier protein Hpr
LHKJJB_17960 LHKJJB_17960 98.8 Morganella morganii S3 ptsH phosphocarrier protein Hpr
HKOGLL_18690 HKOGLL_18690 98.8 Morganella morganii S5 ptsH phosphocarrier protein Hpr
PMI_RS09020 PMI_RS09020 90.6 Proteus mirabilis HI4320 ptsH phosphocarrier protein Hpr
PMI_RS11895 PMI_RS11895 36.5 Proteus mirabilis HI4320 dhaM dihydroxyacetone kinase phosphoryl donor subunit DhaM

Distribution of the homologs in the orthogroup group_339

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_339

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AA09 4.55e-51 157 91 0 85 3 ptsH Phosphocarrier protein HPr Shigella flexneri
P0AA07 4.55e-51 157 91 0 85 1 ptsH Phosphocarrier protein HPr Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AA08 4.55e-51 157 91 0 85 3 ptsH Phosphocarrier protein HPr Salmonella typhi
P0AA04 4.55e-51 157 91 0 85 1 ptsH Phosphocarrier protein HPr Escherichia coli (strain K12)
P0AA05 4.55e-51 157 91 0 85 3 ptsH Phosphocarrier protein HPr Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA06 4.55e-51 157 91 0 85 3 ptsH Phosphocarrier protein HPr Escherichia coli O157:H7
P16481 1.28e-50 156 90 0 85 3 ptsH Phosphocarrier protein HPr Klebsiella pneumoniae
P43921 5.03e-42 134 76 0 85 3 ptsH Phosphocarrier protein HPr Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KTD6 2.18e-39 128 75 0 84 1 ptsH Phosphocarrier protein HPr Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9WXI5 6.1e-39 127 68 0 85 3 ptsH Phosphocarrier protein HPr Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8KA49 3.47e-36 120 64 0 85 3 ptsH Phosphocarrier protein HPr Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89B03 1.27e-32 111 61 0 85 3 ptsH Phosphocarrier protein HPr Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O51507 1.4e-24 90 54 0 81 3 ptsH Phosphocarrier protein HPr Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
O06976 8.61e-20 78 50 0 77 1 crh HPr-like protein Crh Bacillus subtilis (strain 168)
Q9K708 1.39e-16 70 40 0 81 3 crh HPr-like protein Crh Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O69250 5.29e-16 69 41 0 81 1 ptsH Phosphocarrier protein HPr Priestia megaterium
Q9K8D2 2.33e-15 67 42 1 82 3 ptsH Phosphocarrier protein HPr Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9ZAD9 8.46e-15 66 43 0 81 3 ptsH Phosphocarrier protein HPr Lactococcus lactis subsp. cremoris
O07125 1.48e-14 65 39 0 81 3 ptsH Phosphocarrier protein HPr Latilactobacillus sakei
P24366 3.26e-14 64 40 0 81 1 ptsH Phosphocarrier protein HPr Streptococcus salivarius
Q84F84 3.31e-14 64 40 0 84 1 ptsH Phosphocarrier protein HPr Lysinibacillus sphaericus
Q9CJ83 5.01e-14 64 41 0 81 1 ptsH Phosphocarrier protein HPr Lactococcus lactis subsp. lactis (strain IL1403)
P07515 1.21e-13 63 40 0 79 1 ptsH Phosphocarrier protein HPr Enterococcus faecalis (strain ATCC 700802 / V583)
P44715 2.77e-13 66 50 1 76 3 fruB Multiphosphoryl transfer protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44715 2.57e-07 49 37 1 66 3 fruB Multiphosphoryl transfer protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P08877 2.8e-13 62 35 0 81 1 ptsH Phosphocarrier protein HPr Bacillus subtilis (strain 168)
Q9KJV3 2.99e-13 62 46 0 67 1 ptsH Phosphocarrier protein HPr Lacticaseibacillus casei
Q87DQ0 3.9e-13 62 37 0 80 3 ptsH Phosphocarrier protein HPr Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P23534 4.78e-13 61 37 0 81 1 ptsH Phosphocarrier protein HPr Staphylococcus carnosus
Q9EYQ9 2.22e-12 60 35 0 81 1 ptsH Phosphocarrier protein HPr Staphylococcus xylosus
Q9PDH6 2.25e-12 60 36 0 80 3 ptsH Phosphocarrier protein HPr Xylella fastidiosa (strain 9a5c)
Q9WXK8 3.35e-12 59 44 0 67 1 ptsH Phosphocarrier protein HPr Streptococcus equinus
P0A438 5.98e-12 58 33 0 81 3 ptsH Phosphocarrier protein HPr Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A439 5.98e-12 58 33 0 81 3 ptsH Phosphocarrier protein HPr Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P45596 7.66e-12 58 44 0 67 1 ptsH Phosphocarrier protein HPr Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P0A0E2 1.19e-11 58 34 0 81 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain MW2)
P0A0E3 1.19e-11 58 34 0 81 1 ptsH Phosphocarrier protein HPr Staphylococcus aureus
Q6GAD1 1.19e-11 58 34 0 81 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain MSSA476)
Q6GI02 1.19e-11 58 34 0 81 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain MRSA252)
P99143 1.19e-11 58 34 0 81 1 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain N315)
P0A0E1 1.19e-11 58 34 0 81 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH02 1.19e-11 58 34 0 81 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain COL)
P75061 2.71e-11 57 38 1 75 1 ptsH Phosphocarrier protein HPr Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P45611 2.87e-11 57 36 0 74 1 ptsH Phosphocarrier protein HPr Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
P23537 1.69e-10 55 33 0 81 3 phbH Phosphocarrier protein HPr Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9F166 2.52e-10 54 37 0 67 1 ptsH Phosphocarrier protein HPr Bacillus thuringiensis subsp. israelensis
P23388 3.14e-10 57 44 0 63 3 fruB(HI) Multiphosphoryl transfer protein Rhodobacter capsulatus
P45597 7.63e-10 56 37 0 80 3 fruB Multiphosphoryl transfer protein Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P47287 2.23e-09 52 34 1 75 3 ptsH Phosphocarrier protein HPr Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P0DN88 4.49e-09 54 40 0 70 3 dhaM PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM Providencia stuartii (strain MRSN 2154)
P65877 1.48e-08 50 30 0 81 3 ptsH Phosphocarrier protein HPr Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P65876 1.48e-08 50 30 0 81 3 ptsH Phosphocarrier protein HPr Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
D4GYE3 2.28e-08 49 30 1 81 2 ptsH1 Phosphocarrier protein HPr Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q8Z591 6.38e-08 51 35 1 76 3 fruB Multiphosphoryl transfer protein Salmonella typhi
P17127 6.64e-08 51 35 1 76 1 fruB Multiphosphoryl transfer protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P69811 7.61e-08 50 35 1 76 1 fruB Multiphosphoryl transfer protein Escherichia coli (strain K12)
P69812 7.61e-08 50 35 1 76 3 fruB Multiphosphoryl transfer protein Escherichia coli O157:H7
Q9KM70 2.52e-07 49 39 1 73 2 fruB Multiphosphoryl transfer protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O50515 2.77e-07 47 30 1 84 1 ptsH Phosphocarrier protein HPr Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9S0K8 3.55e-07 46 32 0 80 3 ptsO Phosphocarrier protein NPr Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
Q9ZA86 8.89e-07 45 33 1 78 3 ptsO Phosphocarrier protein NPr Proteus mirabilis (strain HI4320)
Q9KP46 1.81e-06 45 35 1 79 3 npr Phosphocarrier protein NPr Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P42013 2.16e-06 44 31 0 63 1 ptsH Phosphocarrier protein HPr Geobacillus stearothermophilus
Q9HVV2 1.05e-05 43 32 1 82 3 ptsH Phosphocarrier protein HPr Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9Z426 1.32e-05 42 31 1 85 3 ptsH Phosphocarrier protein HPr Pseudomonas putida
P37349 1.44e-05 44 30 0 69 1 dhaM PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM Escherichia coli (strain K12)
O83598 2.74e-05 42 30 0 80 3 ptsH Phosphocarrier protein HPr Treponema pallidum (strain Nichols)
D4GL26 0.000112 42 30 0 78 3 dhaM PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM Pantoea ananatis (strain LMG 20103)
A0A0H3H456 0.000255 41 33 0 62 3 dhaM PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM Klebsiella michiganensis (strain ATCC 8724 / DSM 4798 / JCM 20051 / NBRC 3318 / NRRL B-199 / KCTC 1686 / BUCSAV 143 / CCM 1901)
Q9PK56 0.000309 39 27 0 74 3 ptsH Phosphocarrier protein HPr Chlamydia muridarum (strain MoPn / Nigg)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08080
Feature type CDS
Gene ptsH
Product phosphocarrier protein Hpr
Location 1678010 - 1678267 (strand: 1)
Length 258 (nucleotides) / 85 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_339
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00381 PTS HPr component phosphorylation site

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1925 Signal transduction mechanisms (T)
Carbohydrate transport and metabolism (G)		 TG HPr or related phosphotransfer protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02784 phosphocarrier protein HPr Phosphotransferase system (PTS) -

Protein Sequence

MYQQEVTITAPNGLHTRPAAQFVKEAKTFTSDITLTSGGKSASAKSLFKLQTLGLTQGTVVTIAAEGEDEQKAVEHLVKLMGELE

Flanking regions ( +/- flanking 50bp)

TAAATAACCGCCATACCGCCGGCAAAAATTACTAACGATGAGGTAACCCTATGTATCAGCAAGAAGTCACCATTACTGCACCTAACGGTCTGCACACACGCCCTGCGGCTCAGTTTGTCAAAGAAGCAAAAACATTCACATCTGACATTACACTGACTTCCGGCGGCAAAAGCGCCAGCGCGAAAAGCCTGTTCAAGCTGCAAACATTAGGTCTGACTCAGGGCACCGTTGTGACTATCGCCGCAGAAGGCGAAGATGAGCAGAAAGCAGTGGAACATCTCGTCAAACTGATGGGTGAGCTGGAGTAATCCGCTAACCGTCCTCCCTGTCAGTATCCCTGAACCTGTTTAACGGGTTC