Homologs in group_1670

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11610 FBDBKF_11610 90.0 Morganella morganii S1 cysZ sulfate transporter CysZ
EHELCC_17530 EHELCC_17530 90.0 Morganella morganii S2 cysZ sulfate transporter CysZ
NLDBIP_18740 NLDBIP_18740 90.0 Morganella morganii S4 cysZ sulfate transporter CysZ
LHKJJB_17970 LHKJJB_17970 90.0 Morganella morganii S3 cysZ sulfate transporter CysZ
HKOGLL_18680 HKOGLL_18680 90.0 Morganella morganii S5 cysZ sulfate transporter CysZ
PMI_RS09010 PMI_RS09010 62.4 Proteus mirabilis HI4320 cysZ sulfate transporter CysZ

Distribution of the homologs in the orthogroup group_1670

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1670

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q6D8S7 1.89e-117 339 65 0 240 3 cysZ Sulfate transporter CysZ Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8FFB9 1.55e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TF53 1.55e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MY66 1.55e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli O81 (strain ED1a)
Q3YZC9 3.23e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Shigella sonnei (strain Ss046)
B2TWZ5 3.23e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R8V8 3.23e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli (strain UTI89 / UPEC)
B1LMK7 3.23e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli (strain SMS-3-5 / SECEC)
B7N604 3.23e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6J3 3.23e-113 328 64 0 238 1 cysZ Sulfate transporter CysZ Escherichia coli (strain K12)
B1IX58 3.23e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A1ADT0 3.23e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli O1:K1 / APEC
A8A2Q9 3.23e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli O9:H4 (strain HS)
B1XA84 3.23e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli (strain K12 / DH10B)
C4ZVU4 3.23e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli (strain K12 / MC4100 / BW2952)
B5YZW0 3.23e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6J4 3.23e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli O157:H7
B7MHR7 3.23e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UGB4 3.23e-113 328 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0T296 6.37e-113 327 64 0 238 3 cysZ Sulfate transporter CysZ Shigella flexneri serotype 5b (strain 8401)
Q31Y66 6.37e-113 327 64 0 238 3 cysZ Sulfate transporter CysZ Shigella boydii serotype 4 (strain Sb227)
A7ZPL4 8.28e-113 327 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli O139:H28 (strain E24377A / ETEC)
A8ADI0 8.56e-113 327 63 0 238 3 cysZ Sulfate transporter CysZ Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7NPU9 9.04e-113 327 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B6I4Z0 2.32e-112 326 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli (strain SE11)
B7LCF8 2.32e-112 326 64 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli (strain 55989 / EAEC)
Q83QN8 4.47e-112 325 63 0 238 3 cysZ Sulfate transporter CysZ Shigella flexneri
Q32DE0 4.82e-112 325 64 0 238 3 cysZ Sulfate transporter CysZ Shigella dysenteriae serotype 1 (strain Sd197)
B7LL71 5.62e-112 325 63 0 238 3 cysZ Sulfate transporter CysZ Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7M6S3 8.71e-112 324 63 0 238 3 cysZ Sulfate transporter CysZ Escherichia coli O8 (strain IAI1)
Q8Z4W3 3.94e-111 323 63 0 238 3 cysZ Sulfate transporter CysZ Salmonella typhi
B5BB70 3.94e-111 323 63 0 238 3 cysZ Sulfate transporter CysZ Salmonella paratyphi A (strain AKU_12601)
Q5PND3 3.94e-111 323 63 0 238 3 cysZ Sulfate transporter CysZ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5RCQ1 3.94e-111 323 63 0 238 3 cysZ Sulfate transporter CysZ Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3V6 3.94e-111 323 63 0 238 3 cysZ Sulfate transporter CysZ Salmonella enteritidis PT4 (strain P125109)
P12673 5.53e-111 322 62 0 238 3 cysZ Sulfate transporter CysZ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C3LTL7 4.56e-94 279 55 0 242 3 cysZ Sulfate transporter CysZ Vibrio cholerae serotype O1 (strain M66-2)
A5F2W1 4.56e-94 279 55 0 242 3 cysZ Sulfate transporter CysZ Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KTD3 3.8e-93 277 55 0 242 3 cysZ Sulfate transporter CysZ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B7VIK5 7.35e-91 271 52 0 242 3 cysZ Sulfate transporter CysZ Vibrio atlanticus (strain LGP32)
Q87RJ6 3.14e-89 267 53 0 238 3 cysZ Sulfate transporter CysZ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A5UD02 2.85e-81 248 47 0 245 3 cysZ Sulfate transporter CysZ Haemophilus influenzae (strain PittEE)
A5UIM8 9.17e-75 231 46 0 246 3 cysZ Sulfate transporter CysZ Haemophilus influenzae (strain PittGG)
P45039 3.61e-74 229 46 0 246 3 cysZ Sulfate transporter CysZ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CKC9 2.97e-73 227 44 0 246 3 cysZ Sulfate transporter CysZ Pasteurella multocida (strain Pm70)
Q4QLI8 6.52e-73 226 45 0 246 3 cysZ Sulfate transporter CysZ Haemophilus influenzae (strain 86-028NP)
Q02I05 2.55e-63 201 45 2 237 3 cysZ Sulfate transporter CysZ Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UY90 3.9e-63 200 45 2 237 3 cysZ Sulfate transporter CysZ Pseudomonas aeruginosa (strain LESB58)
Q9I595 3.98e-63 200 45 2 237 3 cysZ Sulfate transporter CysZ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6VAD3 6.22e-63 200 45 2 237 3 cysZ Sulfate transporter CysZ Pseudomonas aeruginosa (strain PA7)
Q887V6 1.23e-62 199 43 2 240 3 cysZ Sulfate transporter CysZ Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4KI58 3.67e-62 198 43 2 240 3 cysZ Sulfate transporter CysZ Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3KHX7 4.21e-62 198 42 2 240 3 cysZ Sulfate transporter CysZ Pseudomonas fluorescens (strain Pf0-1)
C3K1X0 1.12e-51 171 42 2 244 3 cysZ Sulfate transporter CysZ Pseudomonas fluorescens (strain SBW25)
P72205 6.2e-12 63 63 0 44 3 cysZ Sulfate transporter CysZ (Fragment) Mannheimia haemolytica

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08070
Feature type CDS
Gene cysZ
Product sulfate transporter CysZ
Location 1675683 - 1676435 (strand: 1)
Length 753 (nucleotides) / 250 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1670
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07264 Sulfate transporter CysZ/Etoposide-induced protein 2.4

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2981 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)		 EP Sulfate transporter CysZ

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06203 CysZ protein - -

Protein Sequence

MINPVRSLSGFAYVAQGWRLMMRPGIRAFVILPLLANIIVMGGALWWLFSRFGGWISWLMAKIPGWLQWLDYLIWPVAVLSILLVFTYFFSTIANIIASPFNGWLAEKLEAELTGRPAPDQGYADLVKDIPRILKREMVKLLYYIPRALVLLVLFFIPGIGQTVAPVLWFIFGAWMMSVQYGDFPFDNHKISFPDMKQTLRRDNMTSLQFGSLVSVLTMIPFVNLFIMPAAVCGATALWVDRYRTQFVRD

Flanking regions ( +/- flanking 50bp)

GTTTCATCTGTTAGTATAACGTTTTCCAATCATAGGAGTGAATAGGAAGTATGATAAATCCTGTCAGGTCGCTCAGCGGCTTTGCGTATGTCGCACAAGGATGGCGGCTGATGATGCGTCCGGGTATCCGGGCCTTTGTTATTTTACCGCTGCTCGCCAATATTATTGTTATGGGCGGTGCGCTCTGGTGGCTGTTCAGCCGGTTCGGCGGCTGGATCTCATGGCTGATGGCAAAAATTCCGGGCTGGTTACAATGGCTGGACTACCTTATCTGGCCGGTTGCCGTCCTCTCCATTTTATTGGTATTTACCTACTTTTTCAGTACGATAGCTAATATTATTGCCTCTCCGTTTAACGGTTGGCTGGCAGAAAAACTGGAAGCAGAGCTTACCGGACGCCCGGCGCCAGATCAGGGCTATGCGGATTTGGTAAAAGATATTCCGCGTATTCTGAAACGGGAAATGGTCAAATTACTGTACTACATTCCCCGCGCCCTTGTTCTCCTGGTCCTGTTTTTCATTCCCGGCATTGGTCAGACGGTAGCCCCGGTGCTCTGGTTTATTTTTGGTGCCTGGATGATGTCGGTTCAGTACGGAGATTTCCCGTTCGATAACCATAAAATTAGTTTTCCGGATATGAAACAGACGCTGCGCCGCGATAACATGACCAGCCTCCAGTTTGGCTCACTGGTCAGCGTGCTGACGATGATCCCGTTTGTGAACCTGTTTATCATGCCTGCTGCGGTCTGCGGCGCAACTGCGCTGTGGGTGGACCGCTACCGCACACAGTTTGTCCGCGACTGATACCCCGCCATTTTCCCGCGCCGGGCGGTAATTATTCCGCCCTGCCGTTT