Homologs in group_1713

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11610 FBDBKF_11610 100.0 Morganella morganii S1 cysZ sulfate transporter CysZ
EHELCC_17530 EHELCC_17530 100.0 Morganella morganii S2 cysZ sulfate transporter CysZ
NLDBIP_18740 NLDBIP_18740 100.0 Morganella morganii S4 cysZ sulfate transporter CysZ
LHKJJB_17970 LHKJJB_17970 100.0 Morganella morganii S3 cysZ sulfate transporter CysZ
F4V73_RS08070 F4V73_RS08070 90.0 Morganella psychrotolerans cysZ sulfate transporter CysZ
PMI_RS09010 PMI_RS09010 63.2 Proteus mirabilis HI4320 cysZ sulfate transporter CysZ

Distribution of the homologs in the orthogroup group_1713

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1713

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q6D8S7 1.72e-115 334 64 0 236 3 cysZ Sulfate transporter CysZ Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8FFB9 1.86e-114 331 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TF53 1.86e-114 331 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MY66 1.86e-114 331 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli O81 (strain ED1a)
Q3YZC9 4.61e-114 330 65 0 240 3 cysZ Sulfate transporter CysZ Shigella sonnei (strain Ss046)
B2TWZ5 4.61e-114 330 65 0 240 3 cysZ Sulfate transporter CysZ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R8V8 4.61e-114 330 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli (strain UTI89 / UPEC)
B1LMK7 4.61e-114 330 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli (strain SMS-3-5 / SECEC)
B7N604 4.61e-114 330 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6J3 4.61e-114 330 65 0 240 1 cysZ Sulfate transporter CysZ Escherichia coli (strain K12)
B1IX58 4.61e-114 330 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A1ADT0 4.61e-114 330 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli O1:K1 / APEC
A8A2Q9 4.61e-114 330 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli O9:H4 (strain HS)
B1XA84 4.61e-114 330 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli (strain K12 / DH10B)
C4ZVU4 4.61e-114 330 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli (strain K12 / MC4100 / BW2952)
B5YZW0 4.61e-114 330 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6J4 4.61e-114 330 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli O157:H7
B7MHR7 4.61e-114 330 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UGB4 4.61e-114 330 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0T296 7.88e-114 329 64 0 240 3 cysZ Sulfate transporter CysZ Shigella flexneri serotype 5b (strain 8401)
Q31Y66 7.88e-114 329 64 0 240 3 cysZ Sulfate transporter CysZ Shigella boydii serotype 4 (strain Sb227)
A7ZPL4 8.98e-114 329 64 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli O139:H28 (strain E24377A / ETEC)
A8ADI0 9.59e-114 329 62 0 245 3 cysZ Sulfate transporter CysZ Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7NPU9 2.68e-113 328 65 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B6I4Z0 2.77e-113 328 64 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli (strain SE11)
B7LCF8 2.77e-113 328 64 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli (strain 55989 / EAEC)
Q83QN8 4.79e-113 327 64 0 240 3 cysZ Sulfate transporter CysZ Shigella flexneri
Q32DE0 5.35e-113 327 64 0 240 3 cysZ Sulfate transporter CysZ Shigella dysenteriae serotype 1 (strain Sd197)
B7M6S3 9.76e-113 327 64 0 240 3 cysZ Sulfate transporter CysZ Escherichia coli O8 (strain IAI1)
P12673 1.14e-112 327 63 0 240 3 cysZ Sulfate transporter CysZ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B7LL71 1.14e-112 327 64 0 240 3 cysZ Sulfate transporter CysZ Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8Z4W3 1.76e-112 326 63 0 240 3 cysZ Sulfate transporter CysZ Salmonella typhi
B5BB70 1.76e-112 326 63 0 240 3 cysZ Sulfate transporter CysZ Salmonella paratyphi A (strain AKU_12601)
Q5PND3 1.76e-112 326 63 0 240 3 cysZ Sulfate transporter CysZ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5RCQ1 1.76e-112 326 63 0 240 3 cysZ Sulfate transporter CysZ Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3V6 1.76e-112 326 63 0 240 3 cysZ Sulfate transporter CysZ Salmonella enteritidis PT4 (strain P125109)
C3LTL7 1.51e-88 265 52 0 238 3 cysZ Sulfate transporter CysZ Vibrio cholerae serotype O1 (strain M66-2)
A5F2W1 1.51e-88 265 52 0 238 3 cysZ Sulfate transporter CysZ Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KTD3 2.88e-88 265 52 0 238 3 cysZ Sulfate transporter CysZ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B7VIK5 4.61e-88 264 50 0 250 3 cysZ Sulfate transporter CysZ Vibrio atlanticus (strain LGP32)
Q87RJ6 6.91e-85 256 50 0 238 3 cysZ Sulfate transporter CysZ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A5UD02 1.61e-80 246 48 0 236 3 cysZ Sulfate transporter CysZ Haemophilus influenzae (strain PittEE)
A5UIM8 6.94e-74 229 46 0 236 3 cysZ Sulfate transporter CysZ Haemophilus influenzae (strain PittGG)
P45039 7.99e-74 228 47 0 236 3 cysZ Sulfate transporter CysZ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QLI8 2.38e-72 225 46 0 236 3 cysZ Sulfate transporter CysZ Haemophilus influenzae (strain 86-028NP)
Q9CKC9 2.62e-72 224 45 0 238 3 cysZ Sulfate transporter CysZ Pasteurella multocida (strain Pm70)
Q3KHX7 1.93e-64 204 44 2 244 3 cysZ Sulfate transporter CysZ Pseudomonas fluorescens (strain Pf0-1)
Q02I05 5.76e-64 202 46 2 236 3 cysZ Sulfate transporter CysZ Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9I595 7.08e-64 202 46 2 236 3 cysZ Sulfate transporter CysZ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7UY90 7.16e-64 202 46 2 236 3 cysZ Sulfate transporter CysZ Pseudomonas aeruginosa (strain LESB58)
Q887V6 8.59e-64 202 45 2 244 3 cysZ Sulfate transporter CysZ Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A6VAD3 1.3e-63 202 46 2 236 3 cysZ Sulfate transporter CysZ Pseudomonas aeruginosa (strain PA7)
Q4KI58 1.59e-63 201 45 2 240 3 cysZ Sulfate transporter CysZ Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C3K1X0 3.91e-54 177 45 2 244 3 cysZ Sulfate transporter CysZ Pseudomonas fluorescens (strain SBW25)
P72205 1.9e-12 64 65 0 44 3 cysZ Sulfate transporter CysZ (Fragment) Mannheimia haemolytica

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_18680
Feature type CDS
Gene cysZ
Product sulfate transporter CysZ
Location 7605 - 8357 (strand: 1)
Length 753 (nucleotides) / 250 (amino acids)
In genomic island -

Contig

Accession ZDB_707
Length 24230 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1713
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07264 Sulfate transporter CysZ/Etoposide-induced protein 2.4

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2981 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)
EP Sulfate transporter CysZ

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06203 CysZ protein - -

Protein Sequence

MTNPVRPLSGFAYVAQGWRLMMRPGLRAFVILPLLANIVVMGGALWWLFSQFGGWIAWLMDKVPGWLQWLDYLIWPVAVISVLLIFSYFFSTIANIIASPFNGWLSEKLEAELTGRPAPDQGWADLINDIPRILKREMVKLLYYIPRAVILLLLFFIPGIGQTLAPVLWFIFGAWMMSVQYGDFPFDNHKVSFPEMKSTLRRDNMTNLQFGSLVSVLTMIPFVNLFIMPAAVCGATALWVDRYRAQFVRD

Flanking regions ( +/- flanking 50bp)

GTTCAGTCTGATAGTATAACGTTTTCCAATCATAGGAGTGAATAGGAAGTATGACAAATCCTGTCAGGCCGCTCAGCGGCTTTGCATATGTTGCACAGGGATGGCGGCTGATGATGCGTCCGGGTCTCCGGGCCTTCGTGATTCTGCCGTTGCTGGCCAATATCGTGGTTATGGGCGGTGCACTCTGGTGGTTGTTCAGTCAGTTCGGCGGGTGGATAGCCTGGCTGATGGATAAAGTACCGGGCTGGCTGCAGTGGCTGGATTATCTTATCTGGCCGGTGGCGGTGATTTCTGTGCTGCTGATTTTCAGCTATTTTTTCAGCACGATCGCCAATATCATCGCCTCGCCGTTTAACGGCTGGCTGTCGGAGAAACTGGAAGCGGAGCTCACCGGGCGTCCCGCACCGGATCAGGGCTGGGCGGATCTGATAAATGATATCCCGCGTATTCTGAAACGTGAGATGGTCAAACTACTTTATTACATCCCGCGTGCCGTTATTCTGCTGCTCCTGTTTTTCATTCCGGGGATCGGGCAGACACTCGCGCCGGTACTCTGGTTTATTTTCGGTGCCTGGATGATGTCCGTGCAGTACGGGGATTTCCCGTTTGATAACCACAAGGTCAGTTTTCCGGAAATGAAAAGCACACTGCGCCGCGATAATATGACCAATCTCCAGTTCGGTTCGCTGGTCAGTGTGCTGACCATGATCCCGTTTGTGAACCTGTTCATTATGCCTGCGGCGGTCTGCGGTGCCACCGCGTTGTGGGTGGATCGCTACCGCGCACAGTTTGTCCGCGACTGATCCGCAACCCCCTTCCGTGCAGGGCGGTTATCACACTGCCCTGCCGTTTT