Homologs in group_2298

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17650 FBDBKF_17650 30.3 Morganella morganii S1 potA ABC-type Fe3+/spermidine/putrescine transport systems, ATPase component
EHELCC_18135 EHELCC_18135 30.3 Morganella morganii S2 potA ABC-type Fe3+/spermidine/putrescine transport systems, ATPase component
NLDBIP_18015 NLDBIP_18015 30.3 Morganella morganii S4 potA ABC-type Fe3+/spermidine/putrescine transport systems, ATPase component
LHKJJB_18210 LHKJJB_18210 30.3 Morganella morganii S3 potA ABC-type Fe3+/spermidine/putrescine transport systems, ATPase component
HKOGLL_17990 HKOGLL_17990 30.3 Morganella morganii S5 potA ABC-type Fe3+/spermidine/putrescine transport systems, ATPase component
F4V73_RS15030 F4V73_RS15030 31.4 Morganella psychrotolerans - ABC transporter ATP-binding protein

Distribution of the homologs in the orthogroup group_2298

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2298

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q035B2 5.77e-40 143 33 4 276 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q6HPN0 8.14e-39 140 35 5 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 8.14e-39 140 35 5 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 8.14e-39 140 35 5 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
Q73F67 1.71e-38 139 35 5 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q63H62 3.21e-38 138 35 5 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q839D5 2.51e-37 136 33 5 243 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q81J16 8.26e-37 135 34 5 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8DRR9 1.1e-35 132 32 4 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q2RFS8 2.16e-35 131 38 4 228 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8VNL9 6.2e-35 130 32 5 237 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Enterococcus faecium
A0PXX7 7.06e-34 127 31 8 264 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium novyi (strain NT)
Q1J982 8.44e-34 127 32 5 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q1WSB8 1.03e-33 127 31 3 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ligilactobacillus salivarius (strain UCC118)
P0C0E9 1.18e-33 126 32 5 234 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 1.18e-33 126 32 5 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 1.18e-33 126 32 5 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 1.18e-33 126 32 5 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 1.18e-33 126 32 5 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7CMM7 1.18e-33 126 32 5 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 1.18e-33 126 32 5 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 1.18e-33 126 32 5 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q48QM2 1.22e-33 126 32 5 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 1.22e-33 126 32 5 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0C0E8 1.22e-33 126 32 5 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
Q8PVG9 1.34e-33 131 32 1 223 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PVG9 3.08e-13 72 29 5 210 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q65P77 2.08e-33 126 33 5 256 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8PSR0 4.36e-33 130 33 1 227 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PSR0 6.51e-24 104 31 3 212 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8TI16 1.26e-32 124 33 11 281 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8R7Y4 1.53e-32 124 33 8 266 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8DMX9 2.58e-32 123 33 5 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97N50 2.58e-32 123 33 5 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HV7 2.58e-32 123 33 5 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8PY27 4.1e-32 122 32 7 237 3 MM_1037 Putative ABC transporter ATP-binding protein MM_1037 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
O59479 4.96e-32 122 30 1 232 3 PH1815 Putative ABC transporter ATP-binding protein PH1815 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q03I82 5.81e-32 122 33 6 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M243 1.29e-31 121 33 6 235 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ3 1.29e-31 121 33 6 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain CNRZ 1066)
Q03EE4 1.31e-31 121 29 4 234 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q9V1Q4 1.67e-31 121 32 3 234 3 PYRAB03730 Putative ABC transporter ATP-binding protein PYRAB03730 Pyrococcus abyssi (strain GE5 / Orsay)
Q5L3R0 2.04e-31 120 31 3 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Geobacillus kaustophilus (strain HTA426)
Q8XHV2 2.04e-31 120 31 6 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain 13 / Type A)
Q0TMS7 2.04e-31 120 31 6 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0SQH5 2.18e-31 120 30 6 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain SM101 / Type A)
Q58488 2.2e-31 120 33 6 236 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q50801 2.29e-31 120 35 5 234 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
A0PXX8 2.79e-31 120 30 7 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium novyi (strain NT)
Q032H4 4.92e-31 119 30 4 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI01 4.92e-31 119 30 4 236 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain MG1363)
Q18CJ0 5.53e-31 119 33 8 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridioides difficile (strain 630)
Q97EK8 6.03e-31 119 32 7 237 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8TSC8 7.51e-31 124 31 1 223 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TSC8 1.41e-11 68 27 8 211 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q045Z8 8.03e-31 119 29 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q6LX68 1.58e-30 118 34 4 220 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q97EK9 1.78e-30 118 28 4 239 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q97X60 2.1e-30 122 32 2 221 3 SSO1893 Putative ABC transporter ATP-binding protein SSO1893 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q97X60 2.15e-11 67 25 3 211 3 SSO1893 Putative ABC transporter ATP-binding protein SSO1893 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q8PYH5 2.16e-30 119 33 2 216 3 MM_0887 Putative ABC transporter ATP-binding protein MM_0887 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q9CIS9 2.3e-30 118 30 4 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. lactis (strain IL1403)
Q890R2 2.33e-30 118 30 8 241 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium tetani (strain Massachusetts / E88)
Q9KXJ6 2.65e-30 122 35 1 217 3 SCO2324 Putative ABC transporter ATP-binding protein SCO2324 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9KXJ6 0.000106 47 27 6 240 3 SCO2324 Putative ABC transporter ATP-binding protein SCO2324 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8TQ05 2.74e-30 122 34 3 227 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQ05 3.48e-26 110 33 4 212 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8DWR3 2.79e-30 117 32 4 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L2 2.79e-30 117 32 4 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF4 2.79e-30 117 32 4 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q97WT4 3.01e-30 122 30 2 221 3 SSO2030 Putative ABC transporter ATP-binding protein SSO2030 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q97WT4 4.8e-13 72 24 4 233 3 SSO2030 Putative ABC transporter ATP-binding protein SSO2030 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q8R7Y5 3.37e-30 117 32 6 242 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q0AUL1 3.39e-30 117 33 4 233 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P40735 4.15e-30 117 30 6 283 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus subtilis (strain 168)
A3DJK3 4.29e-30 117 34 6 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q74L62 5.93e-30 117 29 5 261 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
O27739 2.38e-29 116 31 7 264 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A3CRB9 4.71e-29 114 30 5 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus sanguinis (strain SK36)
Q8TIX0 4.78e-29 115 32 2 211 3 MA_4020 Putative ABC transporter ATP-binding protein MA_4020 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TI15 4.96e-29 114 34 9 241 3 MA_4342 Putative ABC transporter ATP-binding protein MA_4342 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q1GBJ0 5.02e-29 114 31 3 232 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q67JX3 5.33e-29 114 36 5 226 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q82B58 6.7e-29 118 33 2 250 3 SAV_5847 Putative ABC transporter ATP-binding protein SAV_5847 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q82B58 9.8e-07 53 27 5 234 3 SAV_5847 Putative ABC transporter ATP-binding protein SAV_5847 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A3CVD3 7.94e-29 114 31 3 229 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q04BY7 1.1e-28 113 31 3 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q2FRT7 1.52e-28 115 33 7 270 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q38UT9 1.99e-28 113 30 3 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q04EY5 2.81e-28 112 29 3 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q48QM3 2.99e-28 112 33 8 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RH10 3.19e-28 112 33 8 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J450 3.19e-28 112 33 8 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC9 3.19e-28 112 33 8 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJD0 3.19e-28 112 33 8 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J983 3.19e-28 112 33 8 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CMM8 3.19e-28 112 33 8 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B6 3.19e-28 112 33 8 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99XI2 3.19e-28 112 33 8 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M1
Q03I83 4.69e-28 112 31 6 246 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M244 4.69e-28 112 31 6 246 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ4 4.69e-28 112 31 6 246 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain CNRZ 1066)
Q2FNX9 5.9e-28 111 30 3 233 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
P0CZ27 8.14e-28 111 33 8 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ26 8.14e-28 111 33 8 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q88XV2 9.72e-28 111 30 5 261 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q0SWH9 1.1e-27 111 33 2 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q98QH5 1.42e-27 110 28 5 257 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q8ETV7 1.67e-27 110 31 4 222 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q03PY5 2.22e-27 110 30 3 241 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q0TUN8 2.25e-27 110 33 2 215 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8XHV3 3.14e-27 110 28 7 241 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain 13 / Type A)
Q0TMS8 3.14e-27 110 28 7 241 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q5FM63 3.49e-27 109 31 4 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A0ALT7 4.09e-27 109 31 4 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
O26236 5.25e-27 109 32 6 236 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A2RI02 6.09e-27 109 33 9 259 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9Z9J3 9.52e-27 108 34 6 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q2NHA1 1e-26 108 32 6 236 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q8XNY7 1.05e-26 108 32 2 215 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q7A470 2.79e-26 107 29 5 237 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain N315)
Q99S47 2.79e-26 107 29 5 237 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HDY6 3.04e-26 107 29 5 237 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain COL)
Q2FW34 3.04e-26 107 29 5 237 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER7 3.04e-26 107 29 5 237 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain USA300)
Q8Y454 3.63e-26 107 30 4 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q927N8 4.61e-26 106 30 4 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q74DN5 4.69e-26 105 34 3 209 3 GSU1281 Putative ABC transporter ATP-binding protein GSU1281 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q032H3 4.69e-26 107 32 9 259 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain SK11)
Q71WH7 4.86e-26 106 30 4 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serotype 4b (strain F2365)
Q9KGD6 5.2e-26 106 33 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q2YYM4 6.62e-26 105 29 5 237 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GEL3 7.2e-26 105 29 5 237 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MRSA252)
Q890R3 7.8e-26 106 30 5 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium tetani (strain Massachusetts / E88)
Q4A5A5 7.83e-26 105 28 4 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis synoviae (strain 53)
Q9CIS8 8.13e-26 106 32 8 262 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. lactis (strain IL1403)
Q4L885 8.67e-26 105 28 4 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus haemolyticus (strain JCSC1435)
Q8PY26 1.05e-25 105 34 6 211 3 MM_1038 Putative ABC transporter ATP-binding protein MM_1038 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
A3CRB8 1.25e-25 105 31 6 241 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus sanguinis (strain SK36)
Q97N51 1.27e-25 105 31 7 246 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8NVB5 1.38e-25 105 29 6 241 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MW2)
Q6G799 1.38e-25 105 29 6 241 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MSSA476)
Q03ZL6 3.23e-25 104 31 5 216 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q6KHL1 3.58e-25 104 28 3 227 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q73F66 5.38e-25 104 32 5 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8CRI6 5.5e-25 103 29 5 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM27 5.5e-25 103 29 5 234 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6F1W5 5.55e-25 105 29 3 231 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q2LY16 6.13e-25 103 29 5 234 3 cbiO Cobalt import ATP-binding protein CbiO Syntrophus aciditrophicus (strain SB)
Q8DRS0 6.8e-25 103 32 7 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q04FM1 7.2e-25 103 30 11 300 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q51719 7.25e-25 103 36 4 202 3 None Putative ABC transporter ATP-binding protein in cobA 5'region Propionibacterium freudenreichii subsp. shermanii
Q9HMZ4 7.65e-25 102 36 5 219 3 VNG_2317G Putative ABC transporter ATP-binding protein VNG_2317G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q8DMY0 1.19e-24 102 31 7 248 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04HV8 1.19e-24 102 31 7 248 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
O34362 2.03e-24 105 30 4 237 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 7.18e-05 47 25 5 211 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
Q6HPM9 2.94e-24 102 32 5 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ1 2.94e-24 102 32 5 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus anthracis
Q9V2E4 3.26e-24 101 31 5 233 3 PYRAB01300 Putative ABC transporter ATP-binding protein PYRAB01300 Pyrococcus abyssi (strain GE5 / Orsay)
Q97JB8 4.28e-24 101 27 4 233 3 CA_C1368 Putative ABC transporter ATP-binding protein CA_C1368 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q81J15 4.39e-24 101 32 5 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q67JX4 4.74e-24 101 33 5 221 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q73R11 1.04e-23 103 28 3 232 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73R11 7.91e-09 59 26 6 200 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q8R9L8 1.11e-23 103 30 5 231 3 TTE1589 Putative ABC transporter ATP-binding protein TTE1589 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8R9L8 1.23e-22 100 28 5 233 3 TTE1589 Putative ABC transporter ATP-binding protein TTE1589 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q97KZ3 1.32e-23 99 33 5 205 3 CA_C0773 Putative ABC transporter ATP-binding protein CA_C0773 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q81CT8 1.58e-23 103 28 2 237 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 1.53e-11 67 24 4 228 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8DWR4 1.84e-23 99 31 9 245 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L3 1.84e-23 99 31 9 245 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF5 1.84e-23 99 31 9 245 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q737I0 1.98e-23 102 26 3 251 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q737I0 2.04e-14 76 25 4 232 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81N53 2.08e-23 102 32 3 229 3 BA_3364 Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 Bacillus anthracis
Q81N53 0.000316 45 26 7 211 3 BA_3364 Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 Bacillus anthracis
O57872 2.86e-23 99 33 3 204 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
A0R8K9 3e-23 99 31 5 223 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis (strain Al Hakam)
Q2NIT5 3.39e-23 99 29 4 224 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Aster yellows witches'-broom phytoplasma (strain AYWB)
Q63H61 6.2e-23 98 31 5 223 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ZK / E33L)
Q81IZ6 6.6e-23 99 29 2 235 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q748K0 6.68e-23 98 30 5 233 3 GSU3001 Putative ABC transporter ATP-binding protein GSU3001 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q3ABN1 7.42e-23 97 32 5 229 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q839D4 7.88e-23 98 29 6 243 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q6HI76 8.5e-23 100 26 3 251 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HI76 1.45e-12 70 25 5 237 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6YR39 8.82e-23 97 28 4 236 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Onion yellows phytoplasma (strain OY-M)
Q8ETV6 1.09e-22 97 30 8 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q7NAQ6 1.34e-22 97 27 5 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q50294 1.48e-22 97 26 3 219 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q890D1 1.49e-22 96 36 7 207 2 larO Nickel import ATP-binding protein LarO Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8KFD6 1.58e-22 97 31 2 214 3 CT0391 Putative ABC transporter ATP-binding protein CT0391 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q6HG98 1.75e-22 100 32 3 229 3 BT9727_3105 Putative ABC transporter ATP-binding protein BT9727_3105 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HG98 0.000146 46 24 7 237 3 BT9727_3105 Putative ABC transporter ATP-binding protein BT9727_3105 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q8D3Z9 1.91e-22 100 27 2 226 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8D3Z9 3.89e-18 87 26 3 233 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
P70970 1.92e-22 97 31 4 217 3 ecfAB Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus subtilis (strain 168)
Q63H29 2.5e-22 97 29 2 235 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q81VM2 3.55e-22 97 29 2 235 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
P47425 4.17e-22 95 27 3 218 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q81PZ8 4.44e-22 99 26 3 251 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q81PZ8 1.81e-13 73 26 5 237 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q1WSB9 4.53e-22 96 28 7 257 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q8PUE7 5.27e-22 98 27 3 228 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 2.68e-17 84 28 4 223 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q18CI9 7.42e-22 95 27 4 241 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridioides difficile (strain 630)
Q04EY4 9.01e-22 95 28 11 271 3 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q38UU0 1.28e-21 95 29 8 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Latilactobacillus sakei subsp. sakei (strain 23K)
Q8RD07 1.29e-21 94 30 7 239 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q73F11 1.59e-21 95 29 5 242 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8PZN0 1.66e-21 96 32 5 226 3 MM_0462 Putative ABC transporter ATP-binding protein MM_0462 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q82HA2 1.68e-21 94 34 4 204 3 SAV_3608 Putative ABC transporter ATP-binding protein SAV_3608 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q035B3 1.73e-21 94 29 8 240 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
O68106 2.19e-21 94 37 7 224 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q972J5 2.44e-21 96 29 3 216 3 STK_11360 Putative ABC transporter ATP-binding protein STK_11360 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q972J5 9.51e-05 47 30 6 139 3 STK_11360 Putative ABC transporter ATP-binding protein STK_11360 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q9PPV1 2.53e-21 94 27 4 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q4A8A2 2.62e-21 94 27 4 203 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain 7448)
Q601T5 2.62e-21 94 27 4 203 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain 232)
Q83F44 3.1e-21 95 32 5 237 3 metN Methionine import ATP-binding protein MetN Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q7MFH3 3.35e-21 96 27 2 226 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q7MFH3 1.22e-19 91 27 3 233 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q6LQ00 3.73e-21 96 28 2 227 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q6LQ00 5.4e-18 87 24 4 234 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q8U4K3 3.9e-21 94 30 2 210 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O54187 4.01e-21 93 37 5 198 3 SCO5958 Putative ABC transporter ATP-binding protein SCO5958 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q5FM62 5.42e-21 93 31 7 217 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q65P76 5.5e-21 93 30 3 209 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q6FAN3 6.61e-21 94 29 1 228 3 metN1 Methionine import ATP-binding protein MetN 1 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
D5AQY6 6.62e-21 92 35 5 227 1 nikO Nickel import ATP-binding protein NikO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q8TQW9 7.54e-21 95 28 3 228 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQW9 1.05e-15 80 28 3 206 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q7VV72 7.8e-21 94 31 4 240 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4E1 7.8e-21 94 31 4 240 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFU9 7.8e-21 94 31 4 240 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P75355 8.19e-21 92 33 4 181 3 MPN_433 Putative ABC transporter ATP-binding protein MG304 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q4AA75 8.83e-21 92 27 4 203 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q2KVK2 9.14e-21 94 32 2 232 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q7VM95 1.01e-20 93 29 4 237 3 metN Methionine import ATP-binding protein MetN Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q5YZY9 1.03e-20 93 28 4 247 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nocardia farcinica (strain IFM 10152)
Q13LD8 1.09e-20 94 30 1 221 3 metN2 Methionine import ATP-binding protein MetN 2 Paraburkholderia xenovorans (strain LB400)
Q8PGE8 1.14e-20 93 33 5 231 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
Q8TK65 1.18e-20 94 30 6 238 3 MA_3551 Putative ABC transporter ATP-binding protein MA_3551 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
O57896 1.32e-20 93 28 1 210 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q4QK57 1.6e-20 93 31 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q49ZE0 1.75e-20 91 27 3 233 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9CK97 1.93e-20 92 28 4 238 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
Q6MSQ1 2.24e-20 93 28 3 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q3BNZ3 2.25e-20 92 33 5 231 3 metN Methionine import ATP-binding protein MetN Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q88XV1 2.3e-20 91 29 8 262 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q734T1 2.38e-20 94 30 3 246 3 BCE_3323 Putative ABC transporter ATP-binding protein BCE_3323 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q734T1 5.46e-05 47 24 7 238 3 BCE_3323 Putative ABC transporter ATP-binding protein BCE_3323 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8P4S7 2.39e-20 92 33 5 227 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQD2 2.39e-20 92 33 5 227 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
Q2SRI1 2.54e-20 93 27 3 222 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q73P93 2.6e-20 93 25 2 223 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73P93 2.45e-14 76 30 7 205 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q55740 2.66e-20 91 31 4 219 3 sll0385 Putative ABC transporter ATP-binding protein sll0385 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8YA75 2.97e-20 92 30 3 231 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q724C0 3.41e-20 92 30 3 231 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
Q8RHL0 3.67e-20 90 30 5 199 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8EUF1 3.78e-20 90 26 5 233 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Malacoplasma penetrans (strain HF-2)
Q3MAR5 3.79e-20 92 29 3 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q81IN8 4.01e-20 91 29 5 236 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5WJP0 4.1e-20 91 30 3 214 3 metN2 Methionine import ATP-binding protein MetN 2 Shouchella clausii (strain KSM-K16)
Q81ZF5 4.13e-20 91 28 5 236 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q02Z10 4.37e-20 92 25 3 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. cremoris (strain SK11)
Q6HP89 4.66e-20 91 28 5 236 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q1MQ44 4.94e-20 91 25 3 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
Q9CGD4 5.17e-20 92 25 3 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. lactis (strain IL1403)
Q6YRJ4 5.2e-20 92 29 5 239 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q6YRJ4 2.51e-16 82 25 2 232 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q110U3 5.25e-20 92 29 3 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
P45171 5.89e-20 91 30 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q63GR8 5.92e-20 91 28 4 238 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
Q73EL7 6.87e-20 90 28 4 238 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q2NRN5 7.19e-20 90 30 4 241 3 metN Methionine import ATP-binding protein MetN Sodalis glossinidius (strain morsitans)
P9WQM1 7.32e-20 91 29 4 234 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQM0 7.32e-20 91 29 4 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4W3 7.32e-20 91 29 4 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5H503 7.47e-20 90 33 5 231 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q8YM92 7.86e-20 91 29 3 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q65VG9 8.71e-20 90 28 5 245 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q92EZ6 8.98e-20 90 30 3 231 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q87G35 9.06e-20 92 26 2 238 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87G35 4.69e-19 90 26 3 234 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q72FW5 9.3e-20 90 30 3 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q8DIA0 1.01e-19 90 30 6 243 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q5L3Q9 1.11e-19 89 28 6 246 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Geobacillus kaustophilus (strain HTA426)
Q8TIW9 1.12e-19 89 29 7 207 3 MA_4021 Putative ABC transporter ATP-binding protein MA_4021 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q0B6I6 1.23e-19 90 32 2 232 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q03PY6 1.28e-19 89 29 7 242 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q8U4L3 1.3e-19 89 32 4 208 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q74L61 1.41e-19 89 30 8 243 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q49ZD9 1.47e-19 89 27 10 291 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q609Q1 1.49e-19 90 30 6 237 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A3DJK5 1.6e-19 89 28 7 266 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q2P7S3 1.74e-19 89 33 5 231 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q73KT5 2.25e-19 88 28 7 257 3 TDE_2132 Putative ABC transporter ATP-binding protein TDE_2132 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q9RKC6 2.3e-19 88 33 4 204 3 SCO3161 Putative ABC transporter ATP-binding protein SCO3161 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q02ME3 2.42e-19 89 31 1 215 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q88DY1 2.51e-19 88 35 6 220 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q5WDP1 2.64e-19 89 29 1 225 3 metN3 Methionine import ATP-binding protein MetN 3 Shouchella clausii (strain KSM-K16)
Q4QMH4 2.7e-19 89 28 6 242 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain 86-028NP)
Q6LR20 2.85e-19 89 28 1 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
Q6D1C4 2.86e-19 89 31 5 238 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q92UV5 3.37e-19 89 29 2 210 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhizobium meliloti (strain 1021)
Q88ZZ2 3.38e-19 90 28 5 246 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 3.18e-13 72 25 5 227 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q73XU8 3.47e-19 89 29 4 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q92CK1 4.06e-19 87 28 5 230 3 lin1170 Putative ABC transporter ATP-binding protein lin1170 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8UH62 4.44e-19 89 28 3 220 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
O85818 4.62e-19 89 31 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
P74548 4.67e-19 89 28 4 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q832R5 5.08e-19 90 25 2 225 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q832R5 2.99e-15 79 25 4 238 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q045Z7 5.15e-19 87 30 7 241 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8G838 6.01e-19 90 32 6 222 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 2.97e-18 87 29 5 230 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q0KDG3 6.15e-19 88 32 5 237 3 metN Methionine import ATP-binding protein MetN Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q5M397 6.27e-19 89 27 4 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q03JH1 6.39e-19 89 27 4 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5LYN4 6.64e-19 89 27 4 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
Q927N9 6.69e-19 87 27 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9K789 7.17e-19 88 28 1 225 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q6GDC0 7.58e-19 89 28 4 227 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
Q6GDC0 4.16e-15 78 26 6 221 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
Q1LQF6 7.95e-19 88 30 3 234 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q0I5E9 8.28e-19 88 28 3 235 3 metN Methionine import ATP-binding protein MetN Histophilus somni (strain 129Pt)
Q1CFH7 9.04e-19 87 28 7 245 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH38 9.04e-19 87 28 7 245 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q1CAK4 9.04e-19 87 28 7 245 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
A0ALT6 9.9e-19 87 27 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q667L9 1.04e-18 87 30 7 243 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
A1TXH7 1.12e-18 88 28 2 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q8TTN2 1.18e-18 88 31 6 223 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q65M34 1.22e-18 87 29 5 229 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8Y0X3 1.23e-18 87 31 3 223 3 metN Methionine import ATP-binding protein MetN Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q57T09 1.28e-18 87 31 5 238 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella choleraesuis (strain SC-B67)
Q9I1C8 1.3e-18 87 30 1 215 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P44785 1.38e-18 87 29 5 223 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5HIL5 1.45e-18 87 27 5 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain COL)
Q2G0V2 1.45e-18 87 27 5 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJI0 1.45e-18 87 27 5 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain USA300)
Q9MUN1 1.45e-18 87 29 3 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q71WH8 1.47e-18 86 27 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serotype 4b (strain F2365)
Q8Y4L8 1.5e-18 87 28 6 244 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8Y7R4 1.78e-18 85 28 5 230 3 lmo1207 Putative ABC transporter ATP-binding protein lmo1207 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q17VE0 1.78e-18 87 29 3 234 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
Q8XK20 1.8e-18 88 24 5 238 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 1.56e-17 85 26 2 211 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q63NI4 1.87e-18 87 32 2 222 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia pseudomallei (strain K96243)
Q3JHC9 1.98e-18 87 32 2 222 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia pseudomallei (strain 1710b)
Q62B84 1.98e-18 87 32 2 222 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia mallei (strain ATCC 23344)
Q8Y455 2.08e-18 86 27 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9X1Z1 2.17e-18 85 28 6 248 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q6XYZ4 2.21e-18 86 27 4 198 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Spiroplasma kunkelii
Q8DQY5 2.34e-18 88 28 3 229 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8DQY5 4.71e-12 69 28 5 221 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
O32169 2.36e-18 86 25 3 239 1 metN Methionine import ATP-binding protein MetN Bacillus subtilis (strain 168)
Q8YQ88 2.49e-18 85 29 6 237 3 alr3946 Putative ABC transporter ATP-binding protein alr3946 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q88RB3 2.51e-18 87 30 3 236 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1IGN4 2.51e-18 87 31 3 238 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas entomophila (strain L48)
Q6MSQ2 2.53e-18 86 28 6 239 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q1JNE0 2.57e-18 86 27 3 234 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDG6 2.57e-18 86 27 3 234 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8NUH8 2.61e-18 87 28 4 227 3 MW2603 Putative ABC transporter ATP-binding protein MW2603 Staphylococcus aureus (strain MW2)
Q8NUH8 1.77e-14 76 25 5 219 3 MW2603 Putative ABC transporter ATP-binding protein MW2603 Staphylococcus aureus (strain MW2)
Q6G5Z1 2.61e-18 87 28 4 227 3 SAS2569 Putative ABC transporter ATP-binding protein SAS2569 Staphylococcus aureus (strain MSSA476)
Q6G5Z1 1.77e-14 76 25 5 219 3 SAS2569 Putative ABC transporter ATP-binding protein SAS2569 Staphylococcus aureus (strain MSSA476)
P0CZ31 2.81e-18 86 27 3 234 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ30 2.81e-18 86 27 3 234 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q720M2 3.01e-18 85 28 5 230 3 LMOf2365_1216 Putative ABC transporter ATP-binding protein LMOf2365_1216 Listeria monocytogenes serotype 4b (strain F2365)
Q8Z0H0 3.07e-18 86 27 4 241 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q5PID0 3.14e-18 86 31 5 238 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q1WVG9 3.26e-18 86 27 4 240 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
Q5HCL3 3.39e-18 87 28 4 227 3 SACOL2708 Putative ABC transporter ATP-binding protein SACOL2708 Staphylococcus aureus (strain COL)
Q5HCL3 5.55e-15 78 25 5 219 3 SACOL2708 Putative ABC transporter ATP-binding protein SACOL2708 Staphylococcus aureus (strain COL)
Q99QV7 3.43e-18 87 28 4 227 3 SAV2684 Putative ABC transporter ATP-binding protein SAV2684 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q99QV7 4.78e-15 78 25 5 219 3 SAV2684 Putative ABC transporter ATP-binding protein SAV2684 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A342 3.43e-18 87 28 4 227 3 SA2476 Putative ABC transporter ATP-binding protein SA2476 Staphylococcus aureus (strain N315)
Q7A342 4.78e-15 78 25 5 219 3 SA2476 Putative ABC transporter ATP-binding protein SA2476 Staphylococcus aureus (strain N315)
Q8ZRM9 3.75e-18 86 31 5 238 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5M5Z2 3.77e-18 86 26 4 240 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5XDS8 3.77e-18 86 26 3 234 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q832Y6 3.88e-18 86 26 4 241 3 metN1 Methionine import ATP-binding protein MetN 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8NY21 4.61e-18 85 26 5 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MW2)
Q6GC27 4.61e-18 85 26 5 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MSSA476)
Q2SRI2 4.91e-18 85 28 6 239 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q58967 5.13e-18 84 28 12 274 3 MJ1572 Putative ABC transporter ATP-binding protein MJ1572 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q12B04 5.14e-18 85 30 4 238 3 metN Methionine import ATP-binding protein MetN Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q5WXF0 5.21e-18 86 29 4 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q8U3E0 5.32e-18 84 31 6 207 3 PF0528 Putative ABC transporter ATP-binding protein PF0528 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q5M1F6 5.53e-18 85 26 4 240 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain CNRZ 1066)
Q48V78 5.59e-18 85 26 3 234 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A1E3 5.59e-18 85 26 3 234 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
Q21XK2 5.89e-18 85 30 4 238 3 metN Methionine import ATP-binding protein MetN Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q03PF2 6.21e-18 85 29 4 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q1J8E4 6.23e-18 85 26 3 234 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q31J97 6.51e-18 84 31 5 224 3 hmuV Hemin import ATP-binding protein HmuV Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
O29527 6.92e-18 84 29 4 207 3 AF_0731 Putative ABC transporter ATP-binding protein AF_0731 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q3J1N0 6.94e-18 85 31 5 227 3 metN Methionine import ATP-binding protein MetN Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q7MKU3 7.02e-18 85 26 2 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 7.02e-18 85 26 2 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
Q6NBT1 7.17e-18 85 27 5 241 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q71X09 7.26e-18 85 27 6 244 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serotype 4b (strain F2365)
Q63E84 7.81e-18 85 27 3 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ZK / E33L)
Q73BM0 7.81e-18 85 27 3 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBB0 7.81e-18 85 27 3 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis (strain Al Hakam)
Q9KS33 7.97e-18 85 28 1 204 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6HLQ9 8.79e-18 85 27 3 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q3KBH4 9.23e-18 85 29 4 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain Pf0-1)
Q043Y8 9.34e-18 85 27 7 242 3 metN Methionine import ATP-binding protein MetN Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q81TH8 9.61e-18 84 27 3 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus anthracis
Q3KJS6 1.02e-17 85 28 1 225 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain Pf0-1)
Q8P2K6 1.05e-17 85 27 4 237 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q97KD5 1.06e-17 84 26 3 234 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q65F80 1.11e-17 84 27 2 234 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q74IV9 1.13e-17 85 27 6 240 3 metN Methionine import ATP-binding protein MetN Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q93D97 1.17e-17 85 26 5 238 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q93D97 1.39e-16 82 26 5 250 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q65UE1 1.2e-17 85 29 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P56344 1.24e-17 83 27 4 236 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q9V2C0 1.43e-17 84 27 2 210 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus abyssi (strain GE5 / Orsay)
Q928L8 1.45e-17 84 27 6 244 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q1JII9 1.45e-17 84 26 3 234 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q8Z990 1.46e-17 84 31 5 238 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhi
Q97SA3 1.5e-17 85 27 2 228 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q97SA3 1.35e-11 68 27 5 221 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q1BR30 1.59e-17 85 32 2 227 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia orbicola (strain AU 1054)
A0B344 1.59e-17 85 32 2 227 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia cenocepacia (strain HI2424)
Q74I62 1.59e-17 85 25 2 225 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q74I62 1.22e-11 68 23 3 199 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8CRI7 1.6e-17 83 24 7 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5JEB0 1.61e-17 84 29 2 210 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
A1TAI4 1.72e-17 84 26 1 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
P46920 1.73e-17 85 28 3 215 1 opuAA Glycine betaine transport ATP-binding protein OpuAA Bacillus subtilis (strain 168)
Q7A7E3 1.94e-17 84 26 6 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain N315)
Q99WE1 1.94e-17 84 26 6 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q042G7 2.01e-17 84 27 2 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q7CHF8 2.02e-17 84 30 3 232 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis
Q1C970 2.02e-17 84 30 3 232 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q66CQ3 2.02e-17 84 30 3 232 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CG91 2.02e-17 84 30 3 232 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q9CP06 2.02e-17 84 29 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
Q4KK46 2.02e-17 84 30 2 225 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3Z5F8 2.14e-17 84 30 5 238 3 metN Methionine import ATP-binding protein MetN Shigella sonnei (strain Ss046)
Q1RFY9 2.14e-17 84 30 5 238 3 metN Methionine import ATP-binding protein MetN Escherichia coli (strain UTI89 / UPEC)
P63355 2.14e-17 84 30 5 238 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P63356 2.14e-17 84 30 5 238 3 metN Methionine import ATP-binding protein MetN Escherichia coli O157:H7
Q4KC87 2.18e-17 84 32 8 218 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q5ZWE4 2.21e-17 84 29 4 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q0TLD2 2.34e-17 84 30 5 238 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q87PH3 2.39e-17 84 28 1 204 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q5HM28 2.45e-17 83 24 7 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q74K65 2.8e-17 84 30 4 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q325U1 2.82e-17 84 30 5 238 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
Q46Y69 2.87e-17 84 29 3 234 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q49W48 2.87e-17 83 29 4 237 3 metN Methionine import ATP-binding protein MetN Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q03Z27 2.96e-17 84 27 5 244 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q30V33 3.05e-17 84 27 4 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q9X196 3.12e-17 84 28 2 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q39AT4 3.13e-17 84 31 2 227 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q9PDN2 3.19e-17 83 29 2 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
P31134 3.33e-17 84 28 4 232 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
Q5KVK2 3.39e-17 83 26 4 240 3 metN Methionine import ATP-binding protein MetN Geobacillus kaustophilus (strain HTA426)
Q98HF7 3.46e-17 83 30 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q03ZL5 3.5e-17 82 27 7 270 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q4L884 3.53e-17 82 25 7 262 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus haemolyticus (strain JCSC1435)
P9WQL3 3.6e-17 83 31 7 264 1 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQL2 3.6e-17 83 31 7 264 3 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P30750 3.67e-17 83 30 5 238 1 metN Methionine import ATP-binding protein MetN Escherichia coli (strain K12)
Q32JQ8 3.7e-17 83 30 5 238 3 metN Methionine import ATP-binding protein MetN Shigella dysenteriae serotype 1 (strain Sd197)
Q8ES39 3.96e-17 84 33 5 180 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ES39 7.25e-12 68 28 4 211 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q6GJL2 3.97e-17 83 26 5 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MRSA252)
Q1DDP4 4.06e-17 83 31 5 223 3 metN Methionine import ATP-binding protein MetN Myxococcus xanthus (strain DK1622)
Q7N3S7 4.12e-17 82 30 6 239 3 hmuV Hemin import ATP-binding protein HmuV Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q56953 4.29e-17 82 31 9 237 3 yfeB Chelated iron transport system membrane protein YfeB Yersinia pestis
Q1B8V9 4.38e-17 83 26 4 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain MCS)
A1UG51 4.38e-17 83 26 4 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain KMS)
Q0AU85 4.5e-17 83 28 4 238 3 metN Methionine import ATP-binding protein MetN Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q24QI5 4.98e-17 83 29 5 237 3 metN Methionine import ATP-binding protein MetN Desulfitobacterium hafniense (strain Y51)
Q83MC5 5.17e-17 83 30 5 238 3 metN Methionine import ATP-binding protein MetN Shigella flexneri
Q0T810 5.17e-17 83 30 5 238 3 metN Methionine import ATP-binding protein MetN Shigella flexneri serotype 5b (strain 8401)
Q87RS1 5.42e-17 82 28 4 237 1 metN Methionine import ATP-binding protein MetN Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q0BMC9 5.55e-17 83 28 1 210 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3Z2 5.55e-17 83 28 1 210 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain LVS)
Q87DT9 5.96e-17 82 29 2 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q830W6 6.37e-17 82 26 4 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q05596 7.03e-17 81 30 5 220 1 cbiO Cobalt import ATP-binding protein CbiO Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q0RAT5 7.27e-17 83 28 3 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q8DPC2 7.46e-17 82 25 4 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q42 7.46e-17 82 25 4 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JW0 7.46e-17 82 25 4 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q9A502 8.16e-17 82 30 3 221 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A0LUE6 8.27e-17 82 28 4 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q6F1W4 8.44e-17 82 26 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q9KLQ5 8.85e-17 82 26 4 237 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8Z5N5 9.3e-17 81 30 5 220 3 cbiO Cobalt import ATP-binding protein CbiO Salmonella typhi
Q5PDU4 9.3e-17 81 30 5 220 3 cbiO Cobalt import ATP-binding protein CbiO Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q87UV4 9.32e-17 82 28 1 225 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
O26096 9.37e-17 82 28 3 234 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
Q5LT05 9.85e-17 82 28 3 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q72D73 9.86e-17 81 30 7 224 3 DVU_1056 Putative ABC transporter ATP-binding protein DVU_1056 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q48PN3 1.02e-16 82 29 8 294 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q13VD7 1.03e-16 82 29 2 222 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q9YG51 1.04e-16 80 29 4 209 3 pstB Phosphate import ATP-binding protein PstB Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
P14788 1.07e-16 82 28 4 225 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q2RWA3 1.08e-16 82 31 2 211 3 metN Methionine import ATP-binding protein MetN Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q93DA2 1.09e-16 82 25 3 239 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8E3S0 1.11e-16 82 28 5 241 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype III (strain NEM316)
Q2SY12 1.15e-16 82 30 4 235 3 metN Methionine import ATP-binding protein MetN Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8DY54 1.18e-16 82 28 5 241 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3JZP8 1.18e-16 82 28 5 241 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q6NJ07 1.24e-16 82 30 2 205 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q03P57 1.24e-16 82 27 4 229 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q07LR5 1.25e-16 82 31 2 215 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisA53)
Q134N9 1.28e-16 82 30 3 226 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB5)
Q04G50 1.33e-16 82 30 3 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q9TKX3 1.4e-16 81 28 5 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
P55662 1.48e-16 80 28 5 225 3 NGR_a01510 Probable amino-acid ABC transporter ATP-binding protein y4tH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q5NFU5 1.7e-16 81 28 1 210 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q8DFC3 1.72e-16 81 28 3 234 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain CMCP6)
Q81GC1 1.79e-16 81 26 3 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q14H97 1.86e-16 81 28 1 210 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain FSC 198)
Q1B677 1.88e-16 81 32 9 235 3 metN Methionine import ATP-binding protein MetN Mycobacterium sp. (strain MCS)
Q88ZJ6 1.89e-16 81 28 5 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q5HV18 1.91e-16 81 26 4 226 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni (strain RM1221)
Q0PAB6 1.91e-16 81 26 4 226 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q5FL41 1.95e-16 81 27 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q7MN25 1.95e-16 81 28 3 234 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain YJ016)
Q9ZJ34 1.97e-16 81 28 3 234 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain J99 / ATCC 700824)
Q3A9G5 2.1e-16 81 27 4 233 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q63S19 2.13e-16 81 29 4 235 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain K96243)
Q3JPZ4 2.13e-16 81 29 4 235 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain 1710b)
Q62M41 2.13e-16 81 29 4 235 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia mallei (strain ATCC 23344)
Q5E882 2.18e-16 79 28 6 218 3 thiQ Thiamine import ATP-binding protein ThiQ Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8RGC8 2.26e-16 81 25 3 216 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8ELQ6 2.38e-16 81 28 4 238 3 metN3 Methionine import ATP-binding protein MetN 3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q2YVT7 2.4e-16 81 25 3 233 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain bovine RF122 / ET3-1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06470
Feature type CDS
Gene -
Product ABC transporter ATP-binding protein
Location 1348971 - 1349813 (strand: -1)
Length 843 (nucleotides) / 280 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2298
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1122 Inorganic ion transport and metabolism (P)
General function prediction only (R)		 PR Energy-coupling factor transporter ATP-binding protein EcfA2

Protein Sequence

MVVNLQNVTFTPKGAAQPALSLSDFRLASGEWAAVLGGNGSGKSTLAQVLCGWFPELLIGTLTGTADIQGMAPGTHSLVQTAAYRQLVQQSPQLQLSGCAFSVEQEVAFGPENLGLPPQEIEQRVNDALRLTQCDALRHRHPATLSGGEAQRVVIAGALAMRPALLLLDEAFSRMTPAMAHIILMNLKQYSDACGCSVILFERTLFPAADYCDQFFLLEQGKLMATGSLQTVFTAALPVIMMPDAWRLAGQLMLSGHWKGAVPQDDTALIAAFKENHVTP

Flanking regions ( +/- flanking 50bp)

GTGCGTTACGGATTGCTGTTCCTTACCCTGATTGAAGGAGGGTTCCGTCTGTGGTGGTAAATTTACAGAATGTCACCTTTACACCAAAAGGTGCTGCGCAGCCTGCGCTTTCGCTGTCTGATTTCCGGCTGGCGTCAGGTGAGTGGGCGGCGGTACTGGGCGGAAACGGCAGCGGAAAAAGTACCCTGGCGCAGGTATTGTGCGGCTGGTTTCCGGAACTGCTGATCGGAACATTAACCGGTACGGCGGATATTCAGGGCATGGCACCCGGCACGCATTCTCTTGTTCAGACCGCCGCTTACCGGCAACTGGTACAACAATCACCGCAATTGCAGTTATCCGGTTGTGCATTCAGTGTTGAGCAGGAAGTGGCTTTCGGACCGGAAAATCTGGGATTACCTCCGCAGGAGATTGAACAACGGGTGAATGACGCACTGCGGTTGACGCAGTGTGACGCGTTGCGTCACCGGCATCCGGCAACCTTATCCGGCGGGGAAGCCCAGCGGGTGGTGATTGCAGGGGCACTGGCGATGCGACCGGCACTGTTACTGCTCGATGAGGCATTCAGCAGAATGACTCCCGCAATGGCACATATAATTCTGATGAATTTAAAACAGTATTCGGATGCGTGCGGATGCAGTGTCATTTTGTTTGAGCGTACATTGTTCCCGGCGGCGGACTATTGTGATCAATTCTTTTTGCTTGAGCAGGGTAAGCTCATGGCAACAGGCTCTTTGCAGACCGTTTTTACCGCCGCACTGCCGGTGATTATGATGCCGGATGCCTGGCGGCTGGCAGGGCAACTGATGTTAAGCGGACACTGGAAAGGTGCCGTTCCGCAGGATGATACGGCACTGATCGCTGCCTTTAAGGAAAATCATGTTACACCTTGAGAGTCTGAGCTATGCCTGGCCGGGCGCCGGACAAAATTGTATCACTCAAC