Homologs in group_995

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05040 FBDBKF_05040 89.0 Morganella morganii S1 rsxD electron transport complex subunit RsxD
EHELCC_12550 EHELCC_12550 89.0 Morganella morganii S2 rsxD electron transport complex subunit RsxD
NLDBIP_12890 NLDBIP_12890 89.0 Morganella morganii S4 rsxD electron transport complex subunit RsxD
LHKJJB_12750 LHKJJB_12750 89.0 Morganella morganii S3 rsxD electron transport complex subunit RsxD
HKOGLL_11365 HKOGLL_11365 89.0 Morganella morganii S5 rsxD electron transport complex subunit RsxD
PMI_RS06305 PMI_RS06305 67.3 Proteus mirabilis HI4320 rsxD electron transport complex subunit RsxD

Distribution of the homologs in the orthogroup group_995

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_995

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q66AG7 7.5e-159 452 63 0 351 3 rnfD Ion-translocating oxidoreductase complex subunit D Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZED2 1.88e-158 451 63 0 351 3 rnfD Ion-translocating oxidoreductase complex subunit D Yersinia pestis
A7FHZ5 4.17e-158 450 63 0 351 3 rnfD Ion-translocating oxidoreductase complex subunit D Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JM66 6.9e-158 449 63 0 351 3 rnfD Ion-translocating oxidoreductase complex subunit D Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VEQ4 1.32e-157 449 62 1 351 3 rnfD Ion-translocating oxidoreductase complex subunit D Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6D4W1 3.13e-156 445 63 1 349 3 rnfD Ion-translocating oxidoreductase complex subunit D Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MML0 5.48e-155 442 61 1 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Cronobacter sakazakii (strain ATCC BAA-894)
C6DH14 1.25e-154 441 62 1 349 3 rnfD Ion-translocating oxidoreductase complex subunit D Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q32FE3 7.6e-154 439 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Shigella dysenteriae serotype 1 (strain Sd197)
Q8FH94 2.76e-153 438 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B1LEQ6 3.05e-153 438 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain SMS-3-5 / SECEC)
B7NB84 3.11e-153 438 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7LQP0 4.66e-153 437 60 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RBG6 5.2e-153 437 62 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain UTI89 / UPEC)
A1ABH5 5.2e-153 437 62 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O1:K1 / APEC
B7M9Y4 5.2e-153 437 62 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O45:K1 (strain S88 / ExPEC)
B5Z464 7.07e-153 437 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O157:H7 (strain EC4115 / EHEC)
P58325 7.07e-153 437 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O157:H7
B6IB68 7.8e-153 437 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain SE11)
B7M0I7 7.8e-153 437 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O8 (strain IAI1)
B7L5I3 7.8e-153 437 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain 55989 / EAEC)
B7MV12 7.88e-153 437 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O81 (strain ED1a)
B7URX1 8.32e-153 437 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0THJ7 8.6e-153 437 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P76182 9.81e-153 437 61 1 350 1 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain K12)
A8A0H3 9.81e-153 437 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O9:H4 (strain HS)
B1XFU2 9.81e-153 437 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain K12 / DH10B)
C4ZY93 9.81e-153 437 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain K12 / MC4100 / BW2952)
Q0T4E7 1.85e-152 436 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Shigella flexneri serotype 5b (strain 8401)
B1IQC4 2.89e-152 435 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZM90 3.68e-152 435 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3Z1Y5 5.58e-152 435 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Shigella sonnei (strain Ss046)
Q320Y7 8.45e-152 434 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Shigella boydii serotype 4 (strain Sb227)
B2U2C9 8.45e-152 434 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A9MRW9 1.98e-151 433 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7NU03 2.84e-151 433 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q83KY5 1.99e-150 431 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Shigella flexneri
B5BKB3 3.01e-150 430 62 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella paratyphi A (strain AKU_12601)
Q5PIC8 3.01e-150 430 62 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z6Q8 3.63e-150 430 62 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella typhi
A9N026 5.37e-150 430 62 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T593 7.88e-150 429 62 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella newport (strain SL254)
B5F6J1 7.88e-150 429 62 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella agona (strain SL483)
Q8ZPM3 1.55e-149 428 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TV16 1.55e-149 428 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella schwarzengrund (strain CVM19633)
B4THD3 1.55e-149 428 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella heidelberg (strain SL476)
Q57PI1 1.55e-149 428 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella choleraesuis (strain SC-B67)
B5RAK3 2.3e-149 428 62 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QV03 2.3e-149 428 62 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella enteritidis PT4 (strain P125109)
B5FIE8 4.48e-149 427 61 1 350 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella dublin (strain CT_02021853)
A8AH11 2.94e-146 420 62 1 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5XWP8 3.74e-146 420 60 1 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Klebsiella pneumoniae (strain 342)
A4SNP8 2.22e-139 402 58 2 349 3 rnfD Ion-translocating oxidoreductase complex subunit D Aeromonas salmonicida (strain A449)
A0KLJ5 4.47e-139 402 59 3 350 3 rnfD Ion-translocating oxidoreductase complex subunit D Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q7MM84 4.18e-138 399 56 3 352 3 rnfD Ion-translocating oxidoreductase complex subunit D Vibrio vulnificus (strain YJ016)
Q8D887 4.18e-138 399 56 3 352 3 rnfD Ion-translocating oxidoreductase complex subunit D Vibrio vulnificus (strain CMCP6)
B7VLT5 6.99e-137 396 57 2 345 3 rnfD Ion-translocating oxidoreductase complex subunit D Vibrio atlanticus (strain LGP32)
Q87MX1 2.4e-135 392 55 2 345 3 rnfD Ion-translocating oxidoreductase complex subunit D Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q2NSZ8 2.15e-130 380 59 1 347 3 rnfD Ion-translocating oxidoreductase complex subunit D Sodalis glossinidius (strain morsitans)
C3LTR2 3.41e-130 379 56 2 345 3 rnfD Ion-translocating oxidoreductase complex subunit D Vibrio cholerae serotype O1 (strain M66-2)
Q9KT89 3.41e-130 379 56 2 345 3 rnfD Ion-translocating oxidoreductase complex subunit D Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2R1 3.64e-130 379 56 2 345 1 rnfD Ion-translocating oxidoreductase complex subunit D Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q15RL2 2.71e-129 377 51 2 351 3 rnfD Ion-translocating oxidoreductase complex subunit D Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B6EGH4 7.19e-129 376 57 2 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Aliivibrio salmonicida (strain LFI1238)
Q081P4 8.08e-127 371 52 4 352 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella frigidimarina (strain NCIMB 400)
A8H539 3.23e-126 369 50 3 351 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B8CM55 9.19e-126 368 51 3 351 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella piezotolerans (strain WP3 / JCM 13877)
C4LEP4 2.5e-125 367 53 0 344 3 rnfD Ion-translocating oxidoreductase complex subunit D Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q8EE78 3.05e-125 367 51 3 350 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HVF8 1.07e-124 365 52 3 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella sp. (strain MR-7)
Q0HIH7 1.07e-124 365 52 3 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella sp. (strain MR-4)
A0KX82 1.65e-124 365 51 3 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella sp. (strain ANA-3)
A1RJZ5 4.76e-124 363 50 4 352 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella sp. (strain W3-18-1)
A5UBI9 5.72e-124 364 51 4 358 3 rnfD Ion-translocating oxidoreductase complex subunit D Haemophilus influenzae (strain PittEE)
A5UFC3 1.03e-123 363 50 4 358 3 rnfD Ion-translocating oxidoreductase complex subunit D Haemophilus influenzae (strain PittGG)
Q4QJQ5 1.24e-123 363 50 4 358 3 rnfD Ion-translocating oxidoreductase complex subunit D Haemophilus influenzae (strain 86-028NP)
Q57288 1.49e-123 363 50 4 358 3 rnfD Ion-translocating oxidoreductase complex subunit D Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A9L0J8 1.92e-123 362 50 3 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella baltica (strain OS195)
A4Y6I7 2.26e-123 362 50 4 352 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A6WN15 2.29e-123 362 50 3 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella baltica (strain OS185)
A8FUX7 2.7e-123 362 50 3 351 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella sediminis (strain HAW-EB3)
B8E551 2.23e-122 359 50 3 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella baltica (strain OS223)
Q7VNT3 6.02e-122 358 52 2 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q482U6 1.11e-121 358 49 2 350 3 rnfD Ion-translocating oxidoreductase complex subunit D Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q12N27 1.96e-121 357 50 3 351 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q9CNP3 2.79e-120 354 52 3 350 3 rnfD Ion-translocating oxidoreductase complex subunit D Pasteurella multocida (strain Pm70)
Q65U34 4.63e-120 353 54 4 354 3 rnfD Ion-translocating oxidoreductase complex subunit D Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A3MYP1 1.29e-117 347 52 1 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BS74 5.97e-116 343 52 1 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A6VQ43 1.78e-115 342 52 2 353 3 rnfD Ion-translocating oxidoreductase complex subunit D Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B3H011 9.18e-115 340 51 1 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A1SSX2 1.71e-114 339 48 3 351 3 rnfD Ion-translocating oxidoreductase complex subunit D Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q0VP38 4.11e-114 338 50 4 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1S6N2 1.96e-113 337 50 3 350 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B8F7B3 2.61e-113 337 50 3 354 3 rnfD Ion-translocating oxidoreductase complex subunit D Glaesserella parasuis serovar 5 (strain SH0165)
A3QEN7 3.11e-112 333 49 4 351 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8KA19 4.64e-105 315 42 2 350 3 rnfD Ion-translocating oxidoreductase complex subunit D Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AW7 2.2e-103 311 44 5 346 3 rnfD Ion-translocating oxidoreductase complex subunit D Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B8D721 3.93e-101 305 42 2 344 3 rnfD Ion-translocating oxidoreductase complex subunit D Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57216 3.93e-101 305 42 2 344 3 rnfD Ion-translocating oxidoreductase complex subunit D Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8R7 3.93e-101 305 42 2 344 3 rnfD Ion-translocating oxidoreductase complex subunit D Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B3PB33 9.98e-99 299 47 8 354 3 rnfD Ion-translocating oxidoreductase complex subunit D Cellvibrio japonicus (strain Ueda107)
A1TZ62 2.36e-97 296 44 4 347 3 rnfD Ion-translocating oxidoreductase complex subunit D Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q2SKU7 7.56e-97 294 44 5 348 3 rnfD Ion-translocating oxidoreductase complex subunit D Hahella chejuensis (strain KCTC 2396)
A4XS50 7.78e-93 284 44 6 349 3 rnfD Ion-translocating oxidoreductase complex subunit D Pseudomonas mendocina (strain ymp)
Q9HYB7 1.84e-91 280 45 5 349 3 rnfD Ion-translocating oxidoreductase complex subunit D Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02QY1 1.84e-91 280 45 5 349 3 rnfD Ion-translocating oxidoreductase complex subunit D Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UVX0 5.17e-91 279 44 5 349 3 rnfD Ion-translocating oxidoreductase complex subunit D Pseudomonas aeruginosa (strain LESB58)
A6V1T6 3.68e-88 272 45 6 349 3 rnfD Ion-translocating oxidoreductase complex subunit D Pseudomonas aeruginosa (strain PA7)
A1WTR8 6.58e-66 215 38 3 354 3 rnfD Ion-translocating oxidoreductase complex subunit D Halorhodospira halophila (strain DSM 244 / SL1)
Q9EVN4 5.49e-59 197 39 6 352 3 rnfD Ion-translocating oxidoreductase complex subunit D Stutzerimonas stutzeri
H6LC31 9.14e-54 182 34 8 352 1 rnfD Na(+)-translocating ferredoxin:NAD(+) oxidoreductase complex subunit D Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)
D8GR67 1.16e-53 183 33 4 351 2 rnfD Proton-translocating ferredoxin:NAD(+) oxidoreductase complex subunit D Clostridium ljungdahlii (strain ATCC 55383 / DSM 13528 / PETC)
Q52715 6.8e-52 179 38 6 318 1 rnfD Ion-translocating oxidoreductase complex subunit D Rhodobacter capsulatus
Q9HZK7 3.67e-26 111 27 8 304 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PG2 3.67e-26 111 27 8 304 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZT8 3.67e-26 111 27 8 304 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Pseudomonas aeruginosa (strain LESB58)
A6V398 5.74e-26 110 28 9 305 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Pseudomonas aeruginosa (strain PA7)
Q7VNU8 1.28e-25 109 28 6 291 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B5Y1F0 2.54e-25 108 29 8 312 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Klebsiella pneumoniae (strain 342)
A4XSP4 8.67e-25 107 28 7 290 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Pseudomonas mendocina (strain ymp)
Q8ZBZ1 1.05e-24 107 28 7 294 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Yersinia pestis
Q9K0M4 1.21e-24 107 27 9 288 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A6T522 1.57e-24 107 28 8 312 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q9JVP9 1.72e-24 106 27 9 288 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q7MIC8 4.93e-24 105 27 6 291 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio vulnificus (strain YJ016)
Q8DBJ5 4.93e-24 105 27 6 291 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio vulnificus (strain CMCP6)
Q8TSY3 1.09e-23 102 27 8 324 1 rnfD Ion-translocating oxidoreductase complex subunit D Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
A4VMV3 1.29e-23 104 26 6 289 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Stutzerimonas stutzeri (strain A1501)
Q87MA7 1.36e-23 104 27 7 291 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q56587 2.75e-23 103 27 7 291 1 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio alginolyticus
Q9RFW0 3.98e-23 102 27 7 291 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio campbellii (strain ATCC BAA-1116)
C1DR03 6.16e-23 102 28 10 292 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q9CLB0 7.07e-23 102 28 8 285 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Pasteurella multocida (strain Pm70)
Q15YQ5 9.09e-23 101 27 8 292 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
O05011 9.47e-23 101 27 6 284 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UFW9 9.47e-23 101 27 6 284 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Haemophilus influenzae (strain PittGG)
A5UAX2 9.47e-23 101 27 6 284 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Haemophilus influenzae (strain PittEE)
Q4QP23 9.47e-23 101 27 6 284 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Haemophilus influenzae (strain 86-028NP)
Q1QX85 4.65e-22 99 28 6 274 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q75R63 2.05e-21 98 27 7 292 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio anguillarum
Q9KPS2 5.63e-21 96 25 6 297 1 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5X0 5.63e-21 96 25 6 297 1 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q253X4 5.08e-20 94 24 9 389 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia felis (strain Fe/C-56)
Q5L6C0 5.29e-10 64 28 5 152 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia abortus (strain DSM 27085 / S26/3)
Q5L6C0 5.05e-09 61 26 5 212 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia abortus (strain DSM 27085 / S26/3)
Q9Z8B6 1.54e-09 62 38 3 103 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia pneumoniae
Q9Z8B6 1.66e-08 59 30 3 118 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia pneumoniae
Q823P2 2.18e-09 62 28 4 150 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q823P2 3.21e-06 52 26 6 236 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9PKB6 3.53e-09 61 33 4 114 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia muridarum (strain MoPn / Nigg)
Q9PKB6 2.23e-07 56 34 4 120 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia muridarum (strain MoPn / Nigg)
O84280 8.63e-09 60 31 7 145 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
O84280 5.27e-06 52 34 2 89 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KM84 8.63e-09 60 31 7 145 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q3KM84 5.27e-06 52 34 2 89 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0BBQ9 9.78e-09 60 31 7 145 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0BBQ9 5.13e-06 52 34 2 89 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B7J4 9.78e-09 60 31 7 145 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
B0B7J4 5.13e-06 52 34 2 89 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05480
Feature type CDS
Gene rsxD
Product electron transport complex subunit RsxD
Location 1165924 - 1167018 (strand: 1)
Length 1095 (nucleotides) / 364 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_995
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03116 NQR2, RnfD, RnfE family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4658 Energy production and conversion (C) C Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfD subunit

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03614 H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit D [EC:7.1.1.11 7.2.1.2] - -

Protein Sequence

MKFRPVNSNTPHRLKIAGSPFTHNRDNTSAIMLWVVIAMLPGVAAQLWFFGIGTLIQILIAVTTAIVAESVAIRLRKQPVMPYLKDNSALVTAVLLAVSIPPLAPWWLIVTGTFFAVIIAKHLYGGLGQNPFNPAMVGYVVLLISFPVQMTSWLPPESLQIMPISVSDSLHVIFSGLSDQGLTLEQLRAGADGMSQATPLDSFKTGLLTRDMNEILSQPVLQGSVAGIGWQWINIGYLIGGCILLNRRVIAWQVPVAMLGTLAVLAATGYLMDAEHFSTPVMQLFSGATMLGAFFIATDPVTASTTPRGRLIYGALIGLLLWVIRVYGGYPDAVAFSVLLANITVPLIDTYTQPRVYGHKRGNK

Flanking regions ( +/- flanking 50bp)

AAAGCTGCTCAGGCTGCTGAAAAAACCACTGATAATGAAGCGATATAAGCATGAAATTCAGACCCGTTAACTCAAATACACCGCACCGGCTGAAAATCGCAGGGTCACCGTTTACACATAACCGCGACAATACGTCCGCCATCATGCTGTGGGTTGTTATCGCCATGCTGCCGGGCGTTGCCGCACAGCTCTGGTTCTTCGGGATCGGGACACTTATTCAGATACTGATTGCCGTCACCACGGCCATTGTTGCCGAAAGTGTTGCTATCCGTCTGCGCAAACAGCCGGTTATGCCTTATCTGAAAGATAACTCTGCGCTGGTCACTGCGGTGCTCCTTGCGGTCAGTATTCCGCCACTCGCCCCCTGGTGGCTGATTGTCACCGGCACATTCTTTGCCGTGATTATCGCCAAACACCTGTATGGCGGGCTGGGTCAGAACCCGTTTAACCCCGCCATGGTCGGTTATGTGGTGCTGCTTATCTCCTTCCCGGTCCAGATGACAAGCTGGCTGCCGCCTGAAAGCCTGCAAATCATGCCGATTTCAGTCAGTGATAGTCTGCATGTGATTTTCAGCGGATTATCCGATCAGGGGCTGACATTAGAGCAGTTACGCGCGGGTGCCGACGGCATGAGTCAGGCAACGCCGCTGGACAGCTTTAAAACCGGACTGCTGACCCGTGATATGAATGAGATCCTCTCACAACCGGTATTGCAGGGTTCTGTTGCCGGGATTGGCTGGCAGTGGATTAATATCGGGTATCTTATCGGCGGCTGTATTCTGCTGAACCGCCGCGTAATAGCCTGGCAGGTACCGGTGGCAATGCTGGGAACGCTTGCTGTACTGGCAGCCACCGGCTATCTGATGGATGCAGAGCATTTTTCCACGCCGGTTATGCAGCTGTTTTCAGGGGCTACCATGCTGGGTGCATTTTTTATCGCCACAGACCCGGTTACTGCTTCCACCACCCCGCGCGGTCGCCTGATTTACGGCGCGCTGATTGGTCTTTTATTATGGGTTATCCGCGTTTACGGCGGGTATCCGGATGCTGTTGCATTTTCTGTTCTGCTCGCCAATATTACGGTGCCGCTGATTGATACCTATACACAACCCCGTGTTTACGGGCATAAACGGGGAAATAAATGATTGCCACATTGCGCCGTTACGGGTTGATCCTCGCCCTGTTTGCCGCCGGA