Homologs in group_2590

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02935 FBDBKF_02935 93.5 Morganella morganii S1 prpC 2-methylcitrate synthase
EHELCC_03405 EHELCC_03405 93.5 Morganella morganii S2 prpC 2-methylcitrate synthase
NLDBIP_00055 NLDBIP_00055 93.5 Morganella morganii S4 prpC 2-methylcitrate synthase
LHKJJB_01980 LHKJJB_01980 93.5 Morganella morganii S3 prpC 2-methylcitrate synthase
HKOGLL_02020 HKOGLL_02020 93.5 Morganella morganii S5 prpC 2-methylcitrate synthase

Distribution of the homologs in the orthogroup group_2590

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2590

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q937N9 0.0 583 71 2 385 1 prpC 2-methylcitrate synthase Cupriavidus necator
P31660 0.0 568 72 0 374 1 prpC 2-methylcitrate synthase Escherichia coli (strain K12)
Q56063 0.0 564 72 0 374 1 prpC 2-methylcitrate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8EJW2 6.63e-136 395 50 1 368 3 prpC 2-methylcitrate synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P39120 5.44e-80 253 37 5 370 1 citZ Citrate synthase 2 Bacillus subtilis (strain 168)
O34002 4.36e-79 251 39 6 388 1 gltA 2-methylcitrate synthase Antarctic bacterium DS2-3R
Q8NSH7 1.4e-77 247 37 3 378 1 prpC1 2-methylcitrate synthase 1 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8NSL1 2.08e-77 246 39 3 378 1 prpC2 2-methylcitrate synthase 2 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P45858 1.09e-75 242 35 2 369 1 mmgD Citrate/2-methylcitrate synthase Bacillus subtilis (strain 168)
P26491 1.37e-74 239 36 4 387 3 gltA Citrate synthase Mycolicibacterium smegmatis
Q59939 3.35e-74 238 35 3 355 3 citZ Citrate synthase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
I6Y9Q3 1.32e-73 237 37 4 384 1 prpC 2-methylcitrate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
H8F0D7 1.32e-73 237 37 4 384 1 gltA1 2-methylcitrate synthase Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)
Q54KL0 2.95e-73 237 33 8 412 3 DDB_G0287281 Citrate synthase-related protein DDB_G0287281 Dictyostelium discoideum
Q53554 2.98e-73 236 34 5 379 1 gltA Citrate synthase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P51045 2.1e-72 234 34 5 381 3 gltA Citrate synthase Acidithiobacillus ferridurans
P27660 3.66e-72 233 35 2 360 3 ctsA Citrate synthase Heyndrickxia coagulans
D4GS06 2.03e-71 231 35 6 380 1 citZ Citrate synthase Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q9RWB2 2.79e-69 225 34 3 357 1 gltA Citrate synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q59977 1.74e-66 219 32 2 370 3 gltA Citrate synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P80148 1.43e-57 195 31 8 380 1 gltA Citrate synthase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P39119 6.54e-55 188 30 5 362 1 citA Citrate synthase 1 Bacillus subtilis (strain 168)
Q8MQU6 5.79e-54 189 31 7 400 2 cshA Citrate synthase, peroxisomal Dictyostelium discoideum
P42457 1.29e-51 181 32 8 384 3 gltA Citrate synthase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P9WPD5 7.7e-51 179 29 7 387 1 gltA2 Citrate synthase 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPD4 7.7e-51 179 29 7 387 3 gltA2 Citrate synthase 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P49299 1.7e-50 180 31 6 366 1 None Citrate synthase, glyoxysomal Cucurbita maxima
Q86AV6 2.3e-50 179 30 7 387 3 gltA Citrate synthase Dictyostelium discoideum
P20901 1.14e-49 176 31 7 382 1 aarA Citrate synthase Acetobacter aceti
Q9LXS6 3.02e-49 176 30 7 379 2 CSY2 Citrate synthase 2, peroxisomal Arabidopsis thaliana
Q9SJH7 4.01e-49 176 31 8 376 2 CSY3 Citrate synthase 3, peroxisomal Arabidopsis thaliana
Q59732 2.6e-48 172 30 8 371 3 gltA Citrate synthase Rickettsia africae (strain ESF-5)
Q59778 1.22e-47 171 30 8 371 3 gltA Citrate synthase Rickettsia sibirica (strain ATCC VR-151 / 246)
Q59776 1.22e-47 171 30 8 371 3 gltA Citrate synthase Rickettsia slovaca (strain 13-B)
P09948 1.29e-47 170 30 8 371 3 gltA Citrate synthase Rickettsia prowazekii (strain Madrid E)
P21553 1.71e-47 169 30 9 388 1 gltA Citrate synthase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
P51040 1.87e-47 170 30 8 371 3 gltA Citrate synthase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P51043 2.64e-47 169 30 8 371 3 gltA Citrate synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P51041 4.88e-47 168 30 8 365 3 gltA Citrate synthase (Fragment) Rickettsia canadensis
P51042 5.26e-47 169 30 8 371 3 gltA Citrate synthase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P18789 3.16e-46 167 30 9 383 3 gltA Citrate synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q59768 3.2e-46 166 30 8 365 3 gltA Citrate synthase (Fragment) Rickettsia rhipicephali
Q59748 3.2e-46 166 30 8 365 3 gltA Citrate synthase (Fragment) Rickettsia massiliae
Q59759 4.47e-46 166 30 8 365 3 gltA Citrate synthase (Fragment) Rickettsia parkeri
P51038 7.13e-46 166 30 9 372 3 pcsA Citrate synthase, plasmid Rhizobium tropici
P51037 9.65e-46 165 30 9 372 3 ccsA Citrate synthase, chromosomal Rhizobium tropici
Q1RGV8 9.92e-46 165 29 9 384 3 gltA Citrate synthase Rickettsia bellii (strain RML369-C)
Q59741 1.27e-45 164 29 8 365 3 gltA Citrate synthase (Fragment) Rickettsia helvetica
Q59742 1.55e-45 164 30 9 365 3 gltA Citrate synthase (Fragment) Rickettsia japonica
P51039 1.79e-45 164 29 8 365 3 gltA Citrate synthase (Fragment) Rickettsia australis
Q59136 4.08e-45 163 29 8 365 3 gltA Citrate synthase (Fragment) Rickettsia conorii subsp. caspia (strain A-167)
Q59730 2.18e-44 161 29 8 365 3 gltA Citrate synthase (Fragment) Rickettsia akari
P51033 6.35e-44 160 30 9 372 3 gltA Citrate synthase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
P0ABH7 6.79e-44 160 30 11 389 1 gltA Citrate synthase Escherichia coli (strain K12)
P0ABH8 6.79e-44 160 30 11 389 3 gltA Citrate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O33915 7.13e-44 160 29 9 372 3 gltA Citrate synthase Rhizobium meliloti (strain 1021)
Q59734 1.05e-43 159 29 9 366 3 gltA Citrate synthase (Fragment) Rickettsia bellii
O68883 1.46e-43 159 30 11 389 3 gltA Citrate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P20902 5.04e-43 158 31 10 368 3 gltA Citrate synthase Acinetobacter calcoaceticus subsp. anitratus
P51034 1.17e-40 152 29 9 383 3 gltA Citrate synthase Bartonella quintana (strain Toulouse)
P56062 1.8e-40 151 29 9 380 3 gltA Citrate synthase Helicobacter pylori (strain ATCC 700392 / 26695)
P94325 4.15e-40 150 28 10 383 3 gltA Citrate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9ZN37 6.13e-40 150 30 11 370 3 gltA Citrate synthase Helicobacter pylori (strain J99 / ATCC 700824)
P14165 5.17e-39 147 29 9 381 1 gltA Citrate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P9WPD3 6.17e-39 146 32 12 374 1 citA Putative citrate synthase 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPD2 6.17e-39 146 32 12 374 3 citA Putative citrate synthase 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63778 6.17e-39 146 32 12 374 1 citA Putative citrate synthase 2 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9LXS7 5.23e-38 145 27 10 362 2 CSY1 Citrate synthase 1, peroxisomal Arabidopsis thaliana
P51036 2.89e-32 127 28 7 318 3 gltA Citrate synthase (Fragment) Bartonella vinsonii
P51032 1.85e-31 124 28 8 321 3 gltA Citrate synthase (Fragment) Bartonella elizabethae
Q59258 2.2e-31 124 28 7 320 3 gltA Citrate synthase (Fragment) Bartonella taylorii
Q59198 2.25e-31 124 28 8 320 3 gltA Citrate synthase (Fragment) Bartonella doshiae
P51031 1.76e-29 119 28 8 321 3 gltA Citrate synthase (Fragment) Bartonella bacilliformis
Q2TXF1 2.99e-29 121 28 11 374 3 oryE Citrate synthase-like protein oryE Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A0A3G1DJJ8 9.89e-23 102 26 7 353 2 R3 Citrate synthase-like protein Phoma sp. (strain ATCC 20986 / MF5453)
P49298 7.42e-19 91 25 8 318 2 CIT Citrate synthase, mitochondrial Citrus maxima
O80433 9.11e-18 88 25 8 315 2 CS Citrate synthase, mitochondrial Daucus carota
A0A345BJN4 6.72e-15 79 25 6 311 1 clz17 Citrate synthase-like protein clz17 Cochliobolus lunatus
Q9M1D3 1.64e-13 75 24 9 319 1 CSY5 Citrate synthase 5, mitochondrial Arabidopsis thaliana
P00890 3.85e-13 74 25 13 345 1 CIT1 Citrate synthase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P08679 7.42e-13 73 23 12 372 1 CIT2 Citrate synthase, peroxisomal Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P43635 8.11e-13 73 25 15 366 1 CIT3 Citrate synthase 3, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0A348HAY5 9.15e-13 72 23 13 404 1 phiJ Alkylcitrate synthase phiJ Fungal sp. (strain ATCC 74256)
Q553V1 1.6e-12 72 22 13 343 3 cs Citrate synthase, mitochondrial Dictyostelium discoideum
P83372 2.07e-12 72 26 6 237 1 MCSI Citrate synthase, mitochondrial Fragaria ananassa
C7C436 1.02e-11 69 25 14 346 1 mcsA 2-methylcitrate synthase, mitochondrial Gibberella moniliformis
Q6C793 1.05e-11 69 22 12 361 1 YALI0E02684g 2-methylcitrate synthase, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
Q0QHL3 4.17e-11 67 23 12 344 2 None Probable citrate synthase, mitochondrial Glossina morsitans morsitans
P34085 6.64e-11 67 21 10 340 2 cit-1 Citrate synthase, mitochondrial Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
C7C435 6.69e-11 67 24 14 347 1 mcsA 2-methylcitrate synthase, mitochondrial Fusarium solani
P20115 1.22e-10 66 22 9 319 1 CSY4 Citrate synthase 4, mitochondrial Arabidopsis thaliana
A0A0S3QTD0 1.3e-10 66 24 16 357 1 gltA Citrate synthase Thermosulfidibacter takaii (strain DSM 17441 / JCM 13301 / NBRC 103674 / ABI70S6)
Q16P20 1.43e-10 66 24 13 344 3 AAEL011789 Probable citrate synthase 2, mitochondrial Aedes aegypti
Q17GM7 1.52e-10 66 24 12 344 3 AAEL002956 Probable citrate synthase 1, mitochondrial Aedes aegypti
Q9W401 1.63e-10 65 22 11 349 2 Cs1 Probable citrate synthase, mitochondrial Drosophila melanogaster
B8MKZ3 1.69e-10 65 22 9 379 1 tstJ Alkylcitrate synthase tstJ Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
Q61JF9 1.73e-10 65 22 10 345 3 cts-1 Probable citrate synthase, mitochondrial Caenorhabditis briggsae
Q29RK1 2.6e-10 65 23 10 341 1 CS Citrate synthase, mitochondrial Bos taurus
P34575 3.7e-10 65 22 10 345 3 cts-1 Probable citrate synthase, mitochondrial Caenorhabditis elegans
P0C1Z2 6.77e-10 63 23 10 341 2 CS Citrate synthase, mitochondrial Macaca fascicularis
A4H9H8 6.82e-10 63 26 8 210 3 LbrM18_V2.0760 Probable citrate synthase, mitochondrial Leishmania braziliensis
P79024 7.09e-10 63 22 9 341 3 CIT Citrate synthase, mitochondrial Candida tropicalis
P00889 7.3e-10 63 22 9 327 1 CS Citrate synthase, mitochondrial Sus scrofa
Q9CZU6 8.2e-10 63 22 9 327 1 Cs Citrate synthase, mitochondrial Mus musculus
P24118 9.34e-10 63 22 11 330 1 None Citrate synthase, mitochondrial Tetrahymena thermophila
Q8VHF5 1.32e-09 63 22 10 328 1 Cs Citrate synthase, mitochondrial Rattus norvegicus
Q10306 3.24e-09 62 21 12 366 3 cit1 Probable citrate synthase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q43175 5.81e-09 61 24 10 310 2 None Citrate synthase, mitochondrial Solanum tuberosum
P23007 6.05e-09 61 22 10 344 1 CS Citrate synthase, mitochondrial Gallus gallus
Q0GNE1 7.77e-09 60 22 8 326 2 CS Citrate synthase, mitochondrial Amblyrhynchus cristatus
Q7ZWZ5 1e-08 60 22 10 330 2 cs Citrate synthase, mitochondrial Xenopus laevis
Q0GNE0 1.01e-08 60 22 8 326 2 CS Citrate synthase, mitochondrial Iguana iguana
Q0QEL7 1.2e-08 58 26 6 192 1 CS Citrate synthase, mitochondrial (Fragment) Mesocricetus auratus
P51044 1.86e-08 59 21 13 340 2 cit-1 Citrate synthase, mitochondrial Aspergillus niger
Q28DK1 1.89e-08 59 21 8 329 2 cs Citrate synthase, mitochondrial Xenopus tropicalis
Q4S5X1 3.4e-08 58 22 9 326 3 cs Citrate synthase, mitochondrial Tetraodon nigroviridis
Q7ZVY5 3.55e-08 58 22 10 344 2 cs Citrate synthase, mitochondrial Danio rerio
O75390 3.66e-08 58 22 9 327 1 CS Citrate synthase, mitochondrial Homo sapiens
Q4QDX3 3.85e-08 58 26 8 210 3 LmjF18.0680 Probable citrate synthase, mitochondrial Leishmania major
A4HXU4 4.94e-08 58 26 9 210 3 LinJ18.0690 Probable citrate synthase, mitochondrial Leishmania infantum
O00098 6.38e-08 58 21 12 341 2 citA Citrate synthase, mitochondrial Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q6S9V7 1.42e-07 57 25 6 193 2 cs Citrate synthase, mitochondrial Katsuwonus pelamis
Q6S9V8 1.58e-07 56 25 6 193 2 cs Citrate synthase, mitochondrial Thunnus obesus
Q6S9V9 1.58e-07 56 25 6 193 2 cs Citrate synthase, mitochondrial Thunnus albacares
Q6S9V6 2.33e-07 56 22 11 327 2 cs Citrate synthase, mitochondrial Xiphias gladius
Q6S9V5 2.39e-07 56 22 10 327 2 cs Citrate synthase, mitochondrial Kajikia audax
Q50I20 1.37e-06 53 24 15 347 1 mcsA 2-methylcitrate synthase, mitochondrial Aspergillus fumigatus
B0YD89 1.37e-06 53 24 15 347 1 mcsA 2-methylcitrate synthase, mitochondrial Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
P51035 1.5e-06 50 28 3 111 3 gltA Citrate synthase (Fragment) Bartonella vinsonii subsp. berkhoffii
P53585 0.000108 48 24 6 178 3 acly-1 Probable ATP-citrate synthase Caenorhabditis elegans

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05380
Feature type CDS
Gene prpC
Product 2-methylcitrate synthase
Location 1141746 - 1142909 (strand: 1)
Length 1164 (nucleotides) / 387 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2590
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00285 Citrate synthase, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0372 Energy production and conversion (C) C Citrate synthase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01659 2-methylcitrate synthase [EC:2.3.3.5] Propanoate metabolism
Metabolic pathways		 -

Protein Sequence

MTKQLSKSEPTPKKGKKSVALSGVAAGNTALCTVGINGNDLHYRGYDILDLATQCDFEEVAHLLIHEKLPNAAELSAYKVKLKSLRGLPHSVKKALEALPASAHPMDVLRTGVSIMGCVLPEKEGHPLSGARDIADRLLSSLTSMLLYWYHYAFNDRRIDTETDEETAGGHFLRLLHGKTPSAEWVRYMNSSFVLYAEHEFNASTFAARVIAGTGTDFYSAITGAIAALRGPKHGGANEVSLEIQKRYSSPDEAQDDIIARLSRNEVVMGFGHPVYTIADPRHQVIKAISRELSEEAKDFRLFNIADRIESVMSQHKKMFPNLDWFSAVAYHQMGVPTAMFTPIFVIARSAGWAAHIIEQRLDNKIIRPSANYTGPENQTFVPLNAR

Flanking regions ( +/- flanking 50bp)

ACCCTGCAGTTTGAATGAATAGGGGTACATAATAATAAGGAATACCCGTAATGACTAAGCAACTCAGCAAATCTGAACCTACACCGAAGAAAGGTAAAAAATCCGTCGCGCTTTCCGGCGTCGCTGCCGGAAATACCGCACTCTGTACTGTGGGGATCAACGGGAACGACCTGCACTACCGCGGATATGACATCCTGGACTTAGCCACACAATGTGATTTTGAAGAAGTCGCTCATCTTCTGATCCACGAAAAATTGCCGAATGCCGCTGAACTGTCGGCGTATAAAGTCAAACTGAAATCTCTGCGCGGTCTGCCGCACAGTGTGAAAAAAGCACTGGAAGCGCTGCCTGCATCTGCGCATCCGATGGATGTTCTGCGCACAGGCGTATCTATTATGGGTTGTGTTCTGCCTGAAAAAGAAGGGCATCCGTTATCCGGCGCGCGTGATATTGCCGATCGCCTGCTCTCTTCCCTGACCTCAATGCTGCTGTACTGGTATCACTATGCGTTCAATGACCGCCGCATTGATACCGAAACAGACGAAGAAACCGCTGGCGGGCATTTCCTGCGCCTGCTGCATGGTAAAACCCCGTCTGCTGAGTGGGTTCGCTACATGAACTCCTCATTTGTTCTCTATGCCGAGCACGAATTTAATGCCTCGACGTTTGCTGCGCGGGTCATTGCCGGAACCGGTACCGATTTTTATTCGGCGATCACCGGTGCTATCGCTGCTCTGCGCGGACCGAAACACGGCGGCGCAAATGAAGTATCCCTGGAAATTCAGAAACGCTACAGCTCACCGGATGAAGCGCAGGACGATATTATTGCCCGCCTTTCCCGCAATGAAGTGGTGATGGGTTTCGGACACCCGGTGTATACCATCGCTGACCCGCGTCATCAGGTGATCAAAGCTATTTCCCGTGAGTTATCAGAAGAAGCCAAAGATTTCCGCTTATTTAATATCGCCGACCGCATTGAATCTGTGATGTCACAGCACAAGAAAATGTTCCCGAATCTGGACTGGTTCTCTGCGGTTGCTTATCACCAGATGGGTGTTCCGACCGCGATGTTTACCCCGATTTTTGTTATTGCCCGCTCCGCAGGCTGGGCGGCACACATTATTGAACAGCGTCTGGATAATAAAATCATTCGTCCTTCCGCCAATTACACCGGCCCGGAAAACCAGACTTTTGTCCCGTTGAATGCGCGTTAATTATTGAATAATAAGGAATACAGACTATGTCAGCATCCGTTACCCCACGG