Homologs in group_2614

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02935 FBDBKF_02935 100.0 Morganella morganii S1 prpC 2-methylcitrate synthase
NLDBIP_00055 NLDBIP_00055 100.0 Morganella morganii S4 prpC 2-methylcitrate synthase
LHKJJB_01980 LHKJJB_01980 100.0 Morganella morganii S3 prpC 2-methylcitrate synthase
HKOGLL_02020 HKOGLL_02020 100.0 Morganella morganii S5 prpC 2-methylcitrate synthase
F4V73_RS05380 F4V73_RS05380 93.5 Morganella psychrotolerans prpC 2-methylcitrate synthase

Distribution of the homologs in the orthogroup group_2614

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2614

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q937N9 0.0 597 73 1 384 1 prpC 2-methylcitrate synthase Cupriavidus necator
P31660 0.0 577 72 0 374 1 prpC 2-methylcitrate synthase Escherichia coli (strain K12)
Q56063 0.0 573 72 0 374 1 prpC 2-methylcitrate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8EJW2 1.61e-137 400 51 1 368 3 prpC 2-methylcitrate synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P39120 1.16e-81 257 37 6 374 1 citZ Citrate synthase 2 Bacillus subtilis (strain 168)
O34002 1.17e-79 252 40 6 384 1 gltA 2-methylcitrate synthase Antarctic bacterium DS2-3R
Q8NSL1 4.9e-79 251 39 4 378 1 prpC2 2-methylcitrate synthase 2 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q59939 5.27e-76 243 35 3 355 3 citZ Citrate synthase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P45858 6.97e-76 242 34 2 369 1 mmgD Citrate/2-methylcitrate synthase Bacillus subtilis (strain 168)
I6Y9Q3 8.2e-76 243 38 4 378 1 prpC 2-methylcitrate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
H8F0D7 8.2e-76 243 38 4 378 1 gltA1 2-methylcitrate synthase Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)
Q8NSH7 4.07e-75 241 37 5 379 1 prpC1 2-methylcitrate synthase 1 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P26491 6.53e-75 240 37 4 378 3 gltA Citrate synthase Mycolicibacterium smegmatis
P27660 3.48e-73 235 35 2 360 3 ctsA Citrate synthase Heyndrickxia coagulans
Q53554 8.45e-73 234 33 5 379 1 gltA Citrate synthase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P51045 8.61e-73 235 34 5 381 3 gltA Citrate synthase Acidithiobacillus ferridurans
Q9RWB2 8.59e-72 232 35 3 357 1 gltA Citrate synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
D4GS06 4.85e-71 230 35 6 382 1 citZ Citrate synthase Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q54KL0 1.44e-70 230 33 8 412 3 DDB_G0287281 Citrate synthase-related protein DDB_G0287281 Dictyostelium discoideum
Q59977 2.06e-66 219 32 4 390 3 gltA Citrate synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P80148 2.19e-57 194 32 7 377 1 gltA Citrate synthase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P39119 3.66e-57 194 31 3 359 1 citA Citrate synthase 1 Bacillus subtilis (strain 168)
Q8MQU6 1.39e-55 193 32 7 409 2 cshA Citrate synthase, peroxisomal Dictyostelium discoideum
P42457 4.14e-53 185 32 11 391 3 gltA Citrate synthase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P49299 3.31e-52 184 31 7 372 1 None Citrate synthase, glyoxysomal Cucurbita maxima
P9WPD5 2.13e-50 177 30 8 387 1 gltA2 Citrate synthase 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPD4 2.13e-50 177 30 8 387 3 gltA2 Citrate synthase 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9LXS6 3.39e-50 179 30 7 379 2 CSY2 Citrate synthase 2, peroxisomal Arabidopsis thaliana
Q86AV6 3.41e-50 179 31 7 387 3 gltA Citrate synthase Dictyostelium discoideum
Q9SJH7 4.01e-50 179 31 8 376 2 CSY3 Citrate synthase 3, peroxisomal Arabidopsis thaliana
P20901 5.15e-50 177 31 7 382 1 aarA Citrate synthase Acetobacter aceti
Q59732 2.83e-48 172 30 7 382 3 gltA Citrate synthase Rickettsia africae (strain ESF-5)
P09948 4.97e-48 171 30 7 370 3 gltA Citrate synthase Rickettsia prowazekii (strain Madrid E)
P51040 1.03e-47 171 30 7 370 3 gltA Citrate synthase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q59778 1.57e-47 170 29 7 382 3 gltA Citrate synthase Rickettsia sibirica (strain ATCC VR-151 / 246)
Q59776 1.57e-47 170 29 7 382 3 gltA Citrate synthase Rickettsia slovaca (strain 13-B)
P21553 3.08e-47 168 30 9 382 1 gltA Citrate synthase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
P51041 3.35e-47 169 31 7 364 3 gltA Citrate synthase (Fragment) Rickettsia canadensis
Q1RGV8 4.05e-47 169 30 9 384 3 gltA Citrate synthase Rickettsia bellii (strain RML369-C)
P51043 4.09e-47 169 30 7 370 3 gltA Citrate synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P51042 5.54e-47 169 29 7 382 3 gltA Citrate synthase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q59768 3.63e-46 166 30 7 364 3 gltA Citrate synthase (Fragment) Rickettsia rhipicephali
Q59748 3.63e-46 166 30 7 364 3 gltA Citrate synthase (Fragment) Rickettsia massiliae
Q59730 9.48e-46 165 29 7 364 3 gltA Citrate synthase (Fragment) Rickettsia akari
Q59759 1.07e-45 165 30 7 364 3 gltA Citrate synthase (Fragment) Rickettsia parkeri
P18789 1.18e-45 165 28 8 391 3 gltA Citrate synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q59741 1.56e-45 164 29 7 364 3 gltA Citrate synthase (Fragment) Rickettsia helvetica
Q59742 2.99e-45 164 29 7 364 3 gltA Citrate synthase (Fragment) Rickettsia japonica
P51039 3.79e-45 163 29 7 364 3 gltA Citrate synthase (Fragment) Rickettsia australis
P20902 5.01e-45 163 32 10 368 3 gltA Citrate synthase Acinetobacter calcoaceticus subsp. anitratus
Q59136 7.71e-45 162 29 7 364 3 gltA Citrate synthase (Fragment) Rickettsia conorii subsp. caspia (strain A-167)
Q59734 2.01e-44 161 30 9 366 3 gltA Citrate synthase (Fragment) Rickettsia bellii
P51038 1.7e-43 159 30 9 372 3 pcsA Citrate synthase, plasmid Rhizobium tropici
P51037 2.69e-43 159 30 9 372 3 ccsA Citrate synthase, chromosomal Rhizobium tropici
P0ABH7 1.87e-42 156 30 11 389 1 gltA Citrate synthase Escherichia coli (strain K12)
P0ABH8 1.87e-42 156 30 11 389 3 gltA Citrate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O68883 3.11e-42 156 29 11 389 3 gltA Citrate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P51033 1.19e-41 154 30 10 373 3 gltA Citrate synthase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
O33915 2.18e-41 154 29 9 372 3 gltA Citrate synthase Rhizobium meliloti (strain 1021)
P14165 2.16e-40 151 29 10 383 1 gltA Citrate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P51034 3.86e-40 150 29 10 384 3 gltA Citrate synthase Bartonella quintana (strain Toulouse)
P94325 4.06e-40 150 29 12 384 3 gltA Citrate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9LXS7 2.17e-39 149 28 10 362 2 CSY1 Citrate synthase 1, peroxisomal Arabidopsis thaliana
P9WPD3 3.99e-39 146 31 12 374 1 citA Putative citrate synthase 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPD2 3.99e-39 146 31 12 374 3 citA Putative citrate synthase 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63778 3.99e-39 146 31 12 374 1 citA Putative citrate synthase 2 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P56062 1.26e-36 140 27 12 383 3 gltA Citrate synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZN37 3.6e-36 139 29 13 372 3 gltA Citrate synthase Helicobacter pylori (strain J99 / ATCC 700824)
P51031 8.02e-30 120 28 8 321 3 gltA Citrate synthase (Fragment) Bartonella bacilliformis
P51036 1.04e-29 120 28 8 319 3 gltA Citrate synthase (Fragment) Bartonella vinsonii
Q59258 6.19e-29 117 28 9 322 3 gltA Citrate synthase (Fragment) Bartonella taylorii
P51032 6.72e-29 117 28 8 315 3 gltA Citrate synthase (Fragment) Bartonella elizabethae
Q59198 7.83e-29 117 28 7 313 3 gltA Citrate synthase (Fragment) Bartonella doshiae
Q2TXF1 1.57e-28 119 27 7 366 3 oryE Citrate synthase-like protein oryE Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A0A3G1DJJ8 2.34e-24 107 27 6 351 2 R3 Citrate synthase-like protein Phoma sp. (strain ATCC 20986 / MF5453)
P49298 7.84e-19 91 26 9 321 2 CIT Citrate synthase, mitochondrial Citrus maxima
O80433 8.62e-18 88 26 8 315 2 CS Citrate synthase, mitochondrial Daucus carota
A0A345BJN4 1.45e-16 84 25 4 307 1 clz17 Citrate synthase-like protein clz17 Cochliobolus lunatus
P08679 1.12e-14 79 23 12 373 1 CIT2 Citrate synthase, peroxisomal Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P00890 1.82e-14 78 25 13 345 1 CIT1 Citrate synthase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9M1D3 2e-13 75 24 9 319 1 CSY5 Citrate synthase 5, mitochondrial Arabidopsis thaliana
C7C436 3.82e-13 73 25 14 346 1 mcsA 2-methylcitrate synthase, mitochondrial Gibberella moniliformis
P83372 1.73e-12 72 27 6 237 1 MCSI Citrate synthase, mitochondrial Fragaria ananassa
A0A348HAY5 2.32e-12 71 22 11 383 1 phiJ Alkylcitrate synthase phiJ Fungal sp. (strain ATCC 74256)
Q6C793 5.23e-12 70 23 14 386 1 YALI0E02684g 2-methylcitrate synthase, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
C7C435 5.87e-12 70 25 14 352 1 mcsA 2-methylcitrate synthase, mitochondrial Fusarium solani
A0A0S3QTD0 6.01e-12 70 25 17 357 1 gltA Citrate synthase Thermosulfidibacter takaii (strain DSM 17441 / JCM 13301 / NBRC 103674 / ABI70S6)
P43635 7.23e-12 70 25 15 366 1 CIT3 Citrate synthase 3, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P20115 7.25e-12 70 23 9 316 1 CSY4 Citrate synthase 4, mitochondrial Arabidopsis thaliana
Q553V1 9.62e-12 69 22 13 347 3 cs Citrate synthase, mitochondrial Dictyostelium discoideum
P34085 1.65e-11 68 23 10 338 2 cit-1 Citrate synthase, mitochondrial Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
B8MKZ3 2.83e-11 68 22 10 380 1 tstJ Alkylcitrate synthase tstJ Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
Q0QHL3 2.83e-11 68 23 12 339 2 None Probable citrate synthase, mitochondrial Glossina morsitans morsitans
P34575 1.94e-10 65 23 11 348 3 cts-1 Probable citrate synthase, mitochondrial Caenorhabditis elegans
Q10306 3.3e-10 65 22 11 366 3 cit1 Probable citrate synthase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q17GM7 3.59e-10 65 25 13 344 3 AAEL002956 Probable citrate synthase 1, mitochondrial Aedes aegypti
Q16P20 3.63e-10 65 25 13 344 3 AAEL011789 Probable citrate synthase 2, mitochondrial Aedes aegypti
Q61JF9 4.19e-10 64 22 11 348 3 cts-1 Probable citrate synthase, mitochondrial Caenorhabditis briggsae
Q9W401 5.11e-10 64 22 11 349 2 Cs1 Probable citrate synthase, mitochondrial Drosophila melanogaster
P51044 5.71e-10 64 22 12 339 2 cit-1 Citrate synthase, mitochondrial Aspergillus niger
Q43175 8.47e-10 63 26 12 312 2 None Citrate synthase, mitochondrial Solanum tuberosum
P79024 1.58e-09 62 22 11 345 3 CIT Citrate synthase, mitochondrial Candida tropicalis
O00098 3.98e-09 61 22 13 336 2 citA Citrate synthase, mitochondrial Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A4H9H8 5.5e-09 61 26 9 216 3 LbrM18_V2.0760 Probable citrate synthase, mitochondrial Leishmania braziliensis
Q8VHF5 1.03e-08 60 22 10 330 1 Cs Citrate synthase, mitochondrial Rattus norvegicus
Q9CZU6 1.13e-08 60 23 10 330 1 Cs Citrate synthase, mitochondrial Mus musculus
P0C1Z2 1.39e-08 60 23 10 327 2 CS Citrate synthase, mitochondrial Macaca fascicularis
Q0QEL7 3.44e-08 57 27 9 217 1 CS Citrate synthase, mitochondrial (Fragment) Mesocricetus auratus
Q7ZWZ5 3.64e-08 58 22 10 330 2 cs Citrate synthase, mitochondrial Xenopus laevis
Q29RK1 4.41e-08 58 23 11 341 1 CS Citrate synthase, mitochondrial Bos taurus
P24118 5.05e-08 58 22 12 330 1 None Citrate synthase, mitochondrial Tetrahymena thermophila
Q28DK1 5.83e-08 58 22 9 329 2 cs Citrate synthase, mitochondrial Xenopus tropicalis
Q7ZVY5 6.78e-08 57 22 11 344 2 cs Citrate synthase, mitochondrial Danio rerio
P23007 1.03e-07 57 22 11 344 1 CS Citrate synthase, mitochondrial Gallus gallus
P00889 1.18e-07 57 22 10 327 1 CS Citrate synthase, mitochondrial Sus scrofa
Q6S9V6 1.92e-07 56 22 12 327 2 cs Citrate synthase, mitochondrial Xiphias gladius
Q6S9V5 2.33e-07 56 22 11 327 2 cs Citrate synthase, mitochondrial Kajikia audax
Q50I20 2.49e-07 56 25 16 346 1 mcsA 2-methylcitrate synthase, mitochondrial Aspergillus fumigatus
B0YD89 2.49e-07 56 25 16 346 1 mcsA 2-methylcitrate synthase, mitochondrial Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
P51035 6.39e-07 51 33 2 78 3 gltA Citrate synthase (Fragment) Bartonella vinsonii subsp. berkhoffii
Q4QDX3 6.63e-07 54 23 11 309 3 LmjF18.0680 Probable citrate synthase, mitochondrial Leishmania major
O75390 6.95e-07 54 27 7 183 1 CS Citrate synthase, mitochondrial Homo sapiens
A4HXU4 1.23e-06 53 25 8 211 3 LinJ18.0690 Probable citrate synthase, mitochondrial Leishmania infantum
Q6S9V7 1.38e-06 53 22 11 326 2 cs Citrate synthase, mitochondrial Katsuwonus pelamis
Q6S9V8 1.43e-06 53 26 7 192 2 cs Citrate synthase, mitochondrial Thunnus obesus
Q6S9V9 1.43e-06 53 26 7 192 2 cs Citrate synthase, mitochondrial Thunnus albacares
Q4S5X1 2.41e-06 53 22 10 326 3 cs Citrate synthase, mitochondrial Tetraodon nigroviridis
Q9TEM3 2.84e-05 49 28 10 198 1 mcsA 2-methylcitrate synthase, mitochondrial Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P53585 8.41e-05 48 24 9 228 3 acly-1 Probable ATP-citrate synthase Caenorhabditis elegans
P16638 0.001 45 23 9 218 1 Acly ATP-citrate synthase Rattus norvegicus

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_03405
Feature type CDS
Gene prpC
Product 2-methylcitrate synthase
Location 669301 - 670464 (strand: 1)
Length 1164 (nucleotides) / 387 (amino acids)
In genomic island -

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2614
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00285 Citrate synthase, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0372 Energy production and conversion (C) C Citrate synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MNEQLSKPEPALKKGKKSVALSGVAAGNTALCTVGINGNDLHYRGYDILDLATQCDFEEVAHLLIHEKLPNAAELAAYKAKLKSLRGLPHSVKKALEALPASAHPMDVLRTGVSIMGCVLPEKEGHPLSGARDIADRLLSSLTSMLLYWYHYAFNDRRIDTETDDDTCGGHFLHLLHGKKPSENWVRFMNSSFILYAEHEFNASTFAARVIAGTGTDFYSSVTGAIAALRGPKHGGANEVSLEIQKRYSSPDEAQADILARLTRSEVVMGFGHPVYTIADPRHQVIKAISRELSEEAKDFRLFDIADRIESVMSQHKKMFPNLDWFSAVAYHLMGVPTAMFTPIFVIARSAGWAAHIIEQRLDNKIIRPSANYTGPENQTFVPLKAR

Flanking regions ( +/- flanking 50bp)

ATAACGCGAAGCAGGTTGTACACTCACTATAATAATAAGGATCACCCGTCATGAATGAACAACTTAGCAAACCTGAACCTGCACTGAAGAAAGGCAAAAAATCCGTCGCACTGTCCGGCGTTGCTGCCGGCAATACTGCACTCTGTACTGTGGGAATTAACGGGAACGACCTGCATTACCGCGGTTATGACATTCTGGATTTAGCCACACAATGTGATTTTGAAGAAGTCGCTCATCTTCTGATCCATGAAAAACTGCCGAACGCAGCAGAACTGGCCGCTTACAAGGCGAAACTGAAATCACTGCGCGGCCTGCCGCACAGTGTGAAGAAAGCCCTGGAAGCGCTGCCGGCCTCCGCTCACCCGATGGATGTGCTGCGTACCGGCGTGTCCATTATGGGGTGCGTTCTGCCGGAAAAAGAGGGTCATCCGTTATCCGGTGCCCGTGATATCGCTGATCGCCTGCTCTCTTCCCTGACCTCCATGCTGCTTTACTGGTATCACTATGCGTTTAATGATCGCCGCATTGATACCGAAACCGATGACGATACCTGCGGCGGCCATTTCCTGCATCTGCTGCACGGCAAAAAACCATCTGAAAACTGGGTGCGTTTTATGAACTCCTCGTTCATTCTCTATGCAGAACATGAGTTTAACGCCTCCACCTTTGCTGCCCGTGTTATCGCCGGCACCGGAACGGATTTTTACTCCTCCGTCACCGGAGCGATTGCCGCACTGCGCGGACCAAAACACGGCGGTGCCAACGAAGTGTCTCTGGAGATCCAGAAACGTTACAGCTCACCGGATGAAGCTCAGGCGGATATTCTCGCCCGCCTCACCCGCAGTGAAGTCGTGATGGGCTTCGGTCATCCGGTGTATACCATTGCTGACCCGCGTCACCAGGTTATCAAAGCGATTTCCCGTGAGTTATCCGAAGAAGCCAAAGATTTCCGCCTGTTTGATATTGCGGATCGTATTGAATCCGTGATGTCCCAGCATAAAAAGATGTTCCCGAACCTCGACTGGTTCTCAGCGGTGGCGTATCACCTGATGGGTGTGCCGACCGCCATGTTTACCCCGATTTTTGTTATTGCCCGTTCCGCAGGCTGGGCTGCACACATCATTGAACAGCGTTTGGATAATAAAATTATTCGTCCGTCCGCCAATTACACCGGACCGGAAAACCAGACCTTCGTACCCCTTAAAGCGCGCTAATTATTGATTAAAAAGGAAGATAAAGTATGTCAGCATCTTTTACCCCACAG