Homologs in group_2558

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02655 FBDBKF_02655 81.3 Morganella morganii S1 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
EHELCC_03125 EHELCC_03125 81.3 Morganella morganii S2 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
NLDBIP_00335 NLDBIP_00335 81.3 Morganella morganii S4 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
LHKJJB_01700 LHKJJB_01700 81.3 Morganella morganii S3 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
HKOGLL_01740 HKOGLL_01740 81.3 Morganella morganii S5 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Distribution of the homologs in the orthogroup group_2558

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2558

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A0R666 1.31e-05 47 23 3 138 1 ethR HTH-type transcriptional regulator EthR Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P94548 0.000591 42 25 1 96 1 fadR Fatty acid metabolism regulator protein Bacillus subtilis (strain 168)
P03038 0.000614 42 44 0 47 1 tetR Tetracycline repressor protein class A from transposon 1721 Escherichia coli
B7VHK0 0.000618 42 25 0 78 3 slmA Nucleoid occlusion factor SlmA Vibrio atlanticus (strain LGP32)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05155
Feature type CDS
Gene -
Product TetR/AcrR family transcriptional regulator
Location 1099600 - 1100196 (strand: 1)
Length 597 (nucleotides) / 198 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2558
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Protein Sequence

MSGRLQRDERQIQLLNVANSIILEKGTDALTLITLAERAGVTKPVTYKHFGNRKSLLHALFKYSDDALTARMNAQMDQPISDLKDAVTVCITTYFECMADDGEAFNATVAALKAYPEFSDIGLDVQDFFCQILQRSLQTYLPENFRIPEWTAIMIFGATESLCIMMIKDPALKPKVISEAVWLVKTLLADQLSRFSGN

Flanking regions ( +/- flanking 50bp)

CGGGTTCCTGTTTTTAAATTTTTTTATACAACAACAACAAGGAGACGGACTTGTCCGGACGTTTACAGCGCGATGAGCGCCAGATCCAACTGCTGAATGTCGCCAACTCCATCATTCTGGAAAAAGGAACCGATGCGCTGACATTGATCACGCTGGCAGAGAGAGCCGGTGTCACCAAACCGGTGACTTATAAGCATTTCGGCAACCGGAAATCCCTGCTGCATGCACTGTTTAAATACAGTGATGATGCCCTTACCGCCCGGATGAATGCGCAGATGGACCAGCCGATTTCTGATCTGAAAGATGCGGTAACCGTATGTATTACCACTTATTTTGAATGTATGGCGGATGACGGGGAAGCCTTTAACGCCACTGTGGCGGCACTGAAAGCGTATCCGGAATTTTCAGATATCGGATTAGACGTGCAGGATTTTTTCTGTCAGATCCTTCAACGTTCGCTGCAAACATACCTGCCGGAAAATTTCCGGATTCCGGAATGGACGGCTATCATGATTTTCGGGGCGACCGAGTCTTTATGCATCATGATGATCAAAGACCCGGCACTGAAGCCTAAAGTTATCAGTGAAGCTGTCTGGCTGGTCAAAACCTTACTTGCCGATCAACTTAGCCGATTCAGCGGTAACTGACCACCAGCCCCTCTTCTTCTGCCGGATAGCTGAAATGTGCGGTGATCAGG