Homologs in group_1810

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13425 FBDBKF_13425 94.6 Morganella morganii S1 infC translation initiation factor IF-3
EHELCC_08670 EHELCC_08670 94.6 Morganella morganii S2 infC translation initiation factor IF-3
NLDBIP_08995 NLDBIP_08995 94.6 Morganella morganii S4 infC translation initiation factor IF-3
LHKJJB_05270 LHKJJB_05270 94.6 Morganella morganii S3 infC translation initiation factor IF-3
HKOGLL_05645 HKOGLL_05645 94.6 Morganella morganii S5 infC translation initiation factor IF-3
PMI_RS18910 PMI_RS18910 86.6 Proteus mirabilis HI4320 infC translation initiation factor IF-3

Distribution of the homologs in the orthogroup group_1810

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1810

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P33319 2.08e-114 325 86 0 179 3 infC Translation initiation factor IF-3 Proteus hauseri
P33320 1.58e-109 313 85 1 182 3 infC Translation initiation factor IF-3 Serratia marcescens
P33321 9.92e-109 311 92 0 179 3 infC Translation initiation factor IF-3 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z6I3 3.62e-108 309 91 0 179 3 infC Translation initiation factor IF-3 Salmonella typhi
Q6D4G9 4e-108 309 91 0 179 3 infC Translation initiation factor IF-3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5PH88 4.36e-108 309 91 0 179 3 infC Translation initiation factor IF-3 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P0A707 5.61e-108 309 91 0 179 1 infC Translation initiation factor IF-3 Escherichia coli (strain K12)
B1IPL0 5.61e-108 309 91 0 179 3 infC Translation initiation factor IF-3 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A708 5.61e-108 309 91 0 179 3 infC Translation initiation factor IF-3 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
C4ZYI0 5.61e-108 309 91 0 179 3 infC Translation initiation factor IF-3 Escherichia coli (strain K12 / MC4100 / BW2952)
P0A709 5.61e-108 309 91 0 179 3 infC Translation initiation factor IF-3 Escherichia coli O157:H7
B7USA1 5.61e-108 309 91 0 179 3 infC Translation initiation factor IF-3 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P33318 8.06e-108 308 91 0 179 3 infC Translation initiation factor IF-3 Klebsiella pneumoniae
C6DFY7 1.61e-107 308 91 0 179 3 infC Translation initiation factor IF-3 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B4ETK7 1.16e-103 298 86 0 179 3 infC Translation initiation factor IF-3 Proteus mirabilis (strain HI4320)
C4K777 1.85e-103 297 79 1 183 3 infC Translation initiation factor IF-3 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q83L38 2.25e-101 293 79 1 205 3 infC Translation initiation factor IF-3 Shigella flexneri
A1JMK2 3.6e-101 291 89 1 182 3 infC Translation initiation factor IF-3 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q669Z1 1.71e-100 290 88 1 182 3 infC Translation initiation factor IF-3 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZDW6 1.71e-100 290 88 1 182 3 infC Translation initiation factor IF-3 Yersinia pestis
A7FHG2 1.71e-100 290 88 1 182 3 infC Translation initiation factor IF-3 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P46243 2.36e-100 290 85 0 179 3 infC Translation initiation factor IF-3 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B8D731 3.66e-100 289 83 0 179 3 infC Translation initiation factor IF-3 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D8S7 3.66e-100 289 83 0 179 3 infC Translation initiation factor IF-3 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
P57226 5.93e-99 286 83 0 179 3 infC Translation initiation factor IF-3 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P59446 9.67e-92 268 71 2 181 3 infC Translation initiation factor IF-3 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O68844 1.55e-83 247 73 2 183 3 infC Translation initiation factor IF-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8D3B9 2.7e-83 247 64 0 178 3 infC Translation initiation factor IF-3 Wigglesworthia glossinidia brevipalpis
Q9CN42 2.94e-83 246 77 1 180 3 infC Translation initiation factor IF-3 Pasteurella multocida (strain Pm70)
P43814 6.37e-83 245 79 1 170 3 infC Translation initiation factor IF-3 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5QYN5 2.77e-81 241 75 2 181 3 infC Translation initiation factor IF-3 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B1KG60 1.61e-79 237 75 2 171 3 infC Translation initiation factor IF-3 Shewanella woodyi (strain ATCC 51908 / MS32)
Q8XZ28 2.33e-79 236 66 1 173 3 infC Translation initiation factor IF-3 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8EER8 3.87e-79 236 77 2 169 3 infC Translation initiation factor IF-3 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1KSY3 4.11e-79 235 64 1 173 3 infC Translation initiation factor IF-3 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P65138 4.11e-79 235 64 1 173 3 infC Translation initiation factor IF-3 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P65137 4.11e-79 235 64 1 173 3 infC Translation initiation factor IF-3 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F9U3 4.11e-79 235 64 1 173 3 infC Translation initiation factor IF-3 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A6WNH1 4.71e-79 236 77 2 169 3 infC Translation initiation factor IF-3 Shewanella baltica (strain OS185)
B8EES7 4.71e-79 236 77 2 169 3 infC Translation initiation factor IF-3 Shewanella baltica (strain OS223)
B6EN33 1.16e-78 234 73 3 183 3 infC Translation initiation factor IF-3 Aliivibrio salmonicida (strain LFI1238)
Q3IL80 6.74e-78 233 73 1 180 3 infC Translation initiation factor IF-3 Pseudoalteromonas translucida (strain TAC 125)
Q1IC14 1.22e-77 232 63 2 179 3 infC Translation initiation factor IF-3 Pseudomonas entomophila (strain L48)
Q7VKS0 2.07e-77 232 71 1 180 3 infC Translation initiation factor IF-3 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7VY63 3.03e-77 230 69 1 156 3 infC Translation initiation factor IF-3 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W911 3.03e-77 230 69 1 156 3 infC Translation initiation factor IF-3 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WKF6 3.03e-77 230 69 1 156 3 infC Translation initiation factor IF-3 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B1J6U5 3.11e-76 228 63 2 179 3 infC Translation initiation factor IF-3 Pseudomonas putida (strain W619)
Q7NYC5 3.65e-76 228 67 1 173 3 infC Translation initiation factor IF-3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q88K26 5.87e-76 228 63 2 179 3 infC Translation initiation factor IF-3 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KKR7 5.87e-76 228 63 2 179 3 infC Translation initiation factor IF-3 Pseudomonas putida (strain GB-1)
A5W5E0 5.87e-76 228 63 2 179 3 infC Translation initiation factor IF-3 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q5X1H4 2.74e-75 226 66 1 165 3 infC Translation initiation factor IF-3 Legionella pneumophila (strain Paris)
Q5WT83 4.02e-75 226 66 1 165 3 infC Translation initiation factor IF-3 Legionella pneumophila (strain Lens)
Q8RQ01 2.79e-74 223 62 2 179 3 infC Translation initiation factor IF-3 Azotobacter vinelandii
Q9X6E7 7.77e-73 220 64 2 179 3 infC Translation initiation factor IF-3 Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q4KEW3 7.77e-73 220 64 2 179 3 infC Translation initiation factor IF-3 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P0A133 2.45e-72 219 64 2 179 3 infC Translation initiation factor IF-3 Pseudomonas syringae pv. syringae
P0A132 2.45e-72 219 64 2 179 3 infC Translation initiation factor IF-3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C3JZN6 8.92e-72 217 63 2 179 3 infC Translation initiation factor IF-3 Pseudomonas fluorescens (strain SBW25)
Q9I0A0 5.36e-71 215 62 2 179 1 infC Translation initiation factor IF-3 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7VR70 1.03e-70 214 65 0 173 3 infC Translation initiation factor IF-3 Blochmanniella floridana
O33567 3.6e-70 213 60 2 166 3 infC Translation initiation factor IF-3 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q8P7Z3 1.03e-68 209 59 1 167 3 infC Translation initiation factor IF-3 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PJE2 2.86e-68 208 59 1 167 3 infC Translation initiation factor IF-3 Xanthomonas axonopodis pv. citri (strain 306)
Q5P7X6 6.72e-68 207 64 1 166 3 infC Translation initiation factor IF-3 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A7IGN8 9.58e-67 204 56 1 164 3 infC Translation initiation factor IF-3 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A7HPJ7 1.24e-65 201 57 1 164 3 infC Translation initiation factor IF-3 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q9PFE1 1.7e-65 201 56 1 167 3 infC Translation initiation factor IF-3 Xylella fastidiosa (strain 9a5c)
Q5LQ58 2.4e-65 201 58 1 163 3 infC Translation initiation factor IF-3 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q87AB3 2.71e-65 201 56 1 167 3 infC Translation initiation factor IF-3 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0V5P1 3.26e-65 201 61 2 174 3 infC Translation initiation factor IF-3 Acinetobacter baumannii (strain AYE)
B0VV99 3.26e-65 201 61 2 174 3 infC Translation initiation factor IF-3 Acinetobacter baumannii (strain SDF)
A8HWL0 9.78e-65 199 55 1 164 3 infC Translation initiation factor IF-3 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A9ILC8 1.08e-64 199 59 1 164 3 infC Translation initiation factor IF-3 Bartonella tribocorum (strain CIP 105476 / IBS 506)
A6WX21 3.96e-64 197 57 1 164 3 infC Translation initiation factor IF-3 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q6F861 7.35e-64 197 61 2 174 3 infC Translation initiation factor IF-3 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B5ZXR7 8.23e-64 197 56 1 164 3 infC Translation initiation factor IF-3 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
P0A3K9 1.26e-63 196 57 1 164 3 infC Translation initiation factor IF-3 Brucella suis biovar 1 (strain 1330)
P0A3K8 1.26e-63 196 57 1 164 3 infC Translation initiation factor IF-3 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P0A3L0 1.26e-63 196 57 1 164 3 infC Translation initiation factor IF-3 Brucella abortus biovar 1 (strain 9-941)
Q6G570 3.42e-63 195 58 1 164 3 infC Translation initiation factor IF-3 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q6G1I3 1.86e-62 193 57 1 164 3 infC Translation initiation factor IF-3 Bartonella quintana (strain Toulouse)
A1UUD5 6.68e-62 192 57 1 164 3 infC Translation initiation factor IF-3 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q92ST3 1.12e-60 189 54 2 164 3 infC Translation initiation factor IF-3 Rhizobium meliloti (strain 1021)
Q89WH7 1.67e-60 189 53 1 164 3 infC Translation initiation factor IF-3 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q83C11 8.54e-60 187 58 2 169 3 infC Translation initiation factor IF-3 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B1M6P9 1.63e-59 186 55 2 165 3 infC Translation initiation factor IF-3 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q74D03 1.74e-59 186 54 2 171 3 infC Translation initiation factor IF-3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B0UP34 2.75e-59 185 54 2 165 3 infC Translation initiation factor IF-3 Methylobacterium sp. (strain 4-46)
B7KV98 8.2e-59 184 54 2 165 3 infC Translation initiation factor IF-3 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q812P6 9.51e-59 184 53 1 163 3 infC Translation initiation factor IF-3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q98CP5 1.42e-58 184 54 1 164 3 infC Translation initiation factor IF-3 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q5NL80 1.47e-58 184 51 1 164 3 infC Translation initiation factor IF-3 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q633M1 1.57e-58 183 52 1 163 3 infC Translation initiation factor IF-3 Bacillus cereus (strain ZK / E33L)
Q72ZG2 1.57e-58 183 52 1 163 3 infC Translation initiation factor IF-3 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81L15 1.57e-58 183 52 1 163 3 infC Translation initiation factor IF-3 Bacillus anthracis
B1ZGB8 2.58e-58 183 53 2 165 3 infC Translation initiation factor IF-3 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q39VS8 3.96e-58 182 52 2 171 3 infC Translation initiation factor IF-3 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q1DES4 6.5e-58 184 50 2 178 3 infC Translation initiation factor IF-3 Myxococcus xanthus (strain DK1622)
P48516 6.5e-58 184 50 2 178 1 infC Translation initiation factor IF-3 Myxococcus xanthus
Q8R9C2 3.09e-56 178 50 1 171 3 infC Translation initiation factor IF-3 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P03000 3.19e-56 177 53 1 163 1 infC Translation initiation factor IF-3 Geobacillus stearothermophilus
Q5WEI6 7.53e-56 176 50 1 163 3 infC Translation initiation factor IF-3 Shouchella clausii (strain KSM-K16)
P55872 9.5e-56 176 51 1 163 3 infC Translation initiation factor IF-3 Bacillus subtilis (strain 168)
Q2IJB8 2.29e-54 175 52 1 170 3 infC Translation initiation factor IF-3 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q92HK6 3.1e-54 173 49 1 161 3 infC Translation initiation factor IF-3 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
B8J830 4.84e-54 174 52 1 170 3 infC Translation initiation factor IF-3 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A7HBI7 4.85e-54 174 52 1 171 3 infC Translation initiation factor IF-3 Anaeromyxobacter sp. (strain Fw109-5)
B4UAN5 5.14e-54 174 52 1 170 3 infC Translation initiation factor IF-3 Anaeromyxobacter sp. (strain K)
Q837C9 6.21e-54 172 50 1 163 3 infC Translation initiation factor IF-3 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8EPF5 7.57e-54 171 48 1 162 3 infC Translation initiation factor IF-3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B4R9C1 8.91e-54 171 56 1 164 3 infC Translation initiation factor IF-3 Phenylobacterium zucineum (strain HLK1)
Q9K867 1.37e-53 171 50 1 163 3 infC Translation initiation factor IF-3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O88060 2.18e-53 172 50 2 171 3 infC Translation initiation factor IF-3 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q88WU8 4.06e-53 169 45 1 168 3 infC Translation initiation factor IF-3 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8XJ67 7.93e-53 169 57 1 164 3 infC Translation initiation factor IF-3 Clostridium perfringens (strain 13 / Type A)
B8H312 2.77e-52 167 56 1 164 3 infC Translation initiation factor IF-3 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A9D9 2.77e-52 167 56 1 164 3 infC Translation initiation factor IF-3 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q68WK5 2.8e-52 168 48 1 161 3 infC Translation initiation factor IF-3 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZD19 3.41e-52 167 48 1 161 3 infC Translation initiation factor IF-3 Rickettsia prowazekii (strain Madrid E)
Q4ULG2 1.07e-51 166 48 1 161 3 infC Translation initiation factor IF-3 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q74IC4 1.07e-51 166 46 1 162 3 infC Translation initiation factor IF-3 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A4QDY1 1.43e-51 166 49 1 166 3 infC Translation initiation factor IF-3 Corynebacterium glutamicum (strain R)
B8DPN1 1.65e-51 166 49 1 163 3 infC Translation initiation factor IF-3 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B0SY03 2.27e-51 165 56 1 164 3 infC Translation initiation factor IF-3 Caulobacter sp. (strain K31)
Q828D2 3.24e-51 167 50 1 166 3 infC Translation initiation factor IF-3 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8NQP8 4.53e-51 165 49 1 166 3 infC Translation initiation factor IF-3 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q70YI5 6.79e-51 164 50 1 163 3 infC Translation initiation factor IF-3 Thermus thermophilus
Q5SKU2 6.79e-51 164 50 1 163 1 infC Translation initiation factor IF-3 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q9ACJ8 6.79e-51 164 50 1 163 3 infC Translation initiation factor IF-3 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q7NJS6 1.01e-50 164 50 1 164 3 infC Translation initiation factor IF-3 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q8FTQ2 2.5e-50 164 48 1 166 3 infC Translation initiation factor IF-3 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q9Z6R9 2.75e-50 163 47 1 163 3 infC Translation initiation factor IF-3 Chlamydia pneumoniae
B9E784 4.42e-50 162 46 1 164 3 infC Translation initiation factor IF-3 Macrococcus caseolyticus (strain JCSC5402)
Q822B2 5.71e-50 162 47 1 163 3 infC Translation initiation factor IF-3 Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
P0A3L1 7.81e-50 161 48 1 162 3 infC Translation initiation factor IF-3 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71YN3 7.81e-50 161 48 1 162 3 infC Translation initiation factor IF-3 Listeria monocytogenes serotype 4b (strain F2365)
P0A3L2 7.81e-50 161 48 1 162 3 infC Translation initiation factor IF-3 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q662H4 1.02e-49 161 44 1 166 3 infC Translation initiation factor IF-3 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
P65141 1.31e-49 160 53 1 164 3 infC Translation initiation factor IF-3 Staphylococcus aureus (strain MW2)
Q6G8P5 1.31e-49 160 53 1 164 3 infC Translation initiation factor IF-3 Staphylococcus aureus (strain MSSA476)
P65140 1.31e-49 160 53 1 164 1 infC Translation initiation factor IF-3 Staphylococcus aureus (strain N315)
P65139 1.31e-49 160 53 1 164 3 infC Translation initiation factor IF-3 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QHL4 1.31e-49 160 53 1 164 3 infC Translation initiation factor IF-3 Staphylococcus aureus (strain Newman)
Q5HF92 1.31e-49 160 53 1 164 3 infC Translation initiation factor IF-3 Staphylococcus aureus (strain COL)
Q2YTA9 1.31e-49 160 53 1 164 3 infC Translation initiation factor IF-3 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FG56 1.31e-49 160 53 1 164 3 infC Translation initiation factor IF-3 Staphylococcus aureus (strain USA300)
Q9CC22 1.7e-49 161 46 1 166 3 infC Translation initiation factor IF-3 Mycobacterium leprae (strain TN)
A1VBB5 2.11e-49 160 52 1 163 3 infC Translation initiation factor IF-3 Nitratidesulfovibrio vulgaris (strain DP4)
Q728R6 2.11e-49 160 52 1 163 3 infC Translation initiation factor IF-3 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
O84840 2.16e-49 160 46 1 163 3 infC Translation initiation factor IF-3 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P9WKJ9 2.17e-49 161 45 1 166 1 infC Translation initiation factor IF-3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKJ8 2.17e-49 161 45 1 166 3 infC Translation initiation factor IF-3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65136 2.17e-49 161 45 1 166 3 infC Translation initiation factor IF-3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8CS75 2.52e-49 160 53 1 164 3 infC Translation initiation factor IF-3 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNM3 2.52e-49 160 53 1 164 3 infC Translation initiation factor IF-3 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q0SNX3 4.72e-49 160 43 1 166 3 infC Translation initiation factor IF-3 Borreliella afzelii (strain PKo)
Q2FXP9 5.28e-49 159 52 1 164 3 infC Translation initiation factor IF-3 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q6GG25 8.71e-49 159 52 1 164 3 infC Translation initiation factor IF-3 Staphylococcus aureus (strain MRSA252)
B9DNC6 1.14e-48 158 51 1 164 3 infC Translation initiation factor IF-3 Staphylococcus carnosus (strain TM300)
B7J1C3 1.19e-48 159 43 1 166 3 infC Translation initiation factor IF-3 Borreliella burgdorferi (strain ZS7)
O51208 1.19e-48 159 43 1 166 3 infC Translation initiation factor IF-3 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q9PL86 1.31e-48 159 46 1 163 3 infC Translation initiation factor IF-3 Chlamydia muridarum (strain MoPn / Nigg)
O67653 3.44e-48 157 50 2 168 3 infC Translation initiation factor IF-3 Aquifex aeolicus (strain VF5)
Q1IY80 7.46e-48 157 45 0 157 3 infC Translation initiation factor IF-3 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
C1CRU1 7.53e-48 157 53 1 162 3 infC Translation initiation factor IF-3 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CK40 7.53e-48 157 53 1 162 3 infC Translation initiation factor IF-3 Streptococcus pneumoniae (strain P1031)
C1CDV4 7.53e-48 157 53 1 162 3 infC Translation initiation factor IF-3 Streptococcus pneumoniae (strain JJA)
P65145 7.53e-48 157 53 1 162 3 infC Translation initiation factor IF-3 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P65144 7.53e-48 157 53 1 162 1 infC Translation initiation factor IF-3 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZP56 7.53e-48 157 53 1 162 3 infC Translation initiation factor IF-3 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1IBB9 7.53e-48 157 53 1 162 3 infC Translation initiation factor IF-3 Streptococcus pneumoniae (strain Hungary19A-6)
C1C6T6 7.53e-48 157 53 1 162 3 infC Translation initiation factor IF-3 Streptococcus pneumoniae (strain 70585)
Q04KW9 7.53e-48 157 53 1 162 3 infC Translation initiation factor IF-3 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P72874 1.03e-47 156 49 2 172 3 infC Translation initiation factor IF-3 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P65143 2.81e-47 155 53 1 162 3 infC Translation initiation factor IF-3 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P65142 2.81e-47 155 53 1 162 3 infC Translation initiation factor IF-3 Streptococcus agalactiae serotype III (strain NEM316)
Q3K0C8 2.81e-47 155 53 1 162 3 infC Translation initiation factor IF-3 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q49YB2 9.13e-47 154 50 1 164 3 infC Translation initiation factor IF-3 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q3MBH6 9.6e-47 154 46 1 165 3 infC Translation initiation factor IF-3 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8YNE3 9.6e-47 154 46 1 165 3 infC Translation initiation factor IF-3 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q03KI9 1.03e-46 153 52 1 162 3 infC Translation initiation factor IF-3 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
A6L7J6 1.07e-46 154 49 2 166 3 infC Translation initiation factor IF-3 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
B5E478 1.1e-46 154 52 1 162 3 infC Translation initiation factor IF-3 Streptococcus pneumoniae serotype 19F (strain G54)
B9DU40 1.29e-46 153 53 1 162 3 infC Translation initiation factor IF-3 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q1XDQ6 1.48e-46 153 42 2 177 3 infC Translation initiation factor IF-3, chloroplastic Neopyropia yezoensis
Q8DIG8 1.72e-46 153 45 2 174 3 infC Translation initiation factor IF-3 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
C0MGM0 2.25e-46 152 52 1 162 3 infC Translation initiation factor IF-3 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U2J9 2.25e-46 152 52 1 162 3 infC Translation initiation factor IF-3 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M8S9 2.25e-46 152 52 1 162 3 infC Translation initiation factor IF-3 Streptococcus equi subsp. equi (strain 4047)
B2S488 2.66e-46 152 43 1 179 3 infC Translation initiation factor IF-3 Treponema pallidum subsp. pallidum (strain SS14)
O83822 2.66e-46 152 43 1 179 3 infC Translation initiation factor IF-3 Treponema pallidum (strain Nichols)
B2IY66 3.74e-46 152 46 1 165 3 infC Translation initiation factor IF-3 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q5M470 4.56e-46 152 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
C1D0V9 4.7e-46 153 44 0 157 3 infC Translation initiation factor IF-3 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
A1QYY5 6.44e-46 152 42 1 166 3 infC Translation initiation factor IF-3 Borrelia turicatae (strain 91E135)
B5XKT8 6.98e-46 151 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DB87 6.98e-46 151 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48U94 6.98e-46 151 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RF84 6.98e-46 151 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JHJ7 6.98e-46 151 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JMF0 6.98e-46 151 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JCH2 6.98e-46 151 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P65148 6.98e-46 151 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCU2 6.98e-46 151 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DB86 6.98e-46 151 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P65146 6.98e-46 151 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus pyogenes serotype M1
Q5LZL7 7.13e-46 151 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus thermophilus (strain CNRZ 1066)
B1XM04 7.83e-46 151 47 2 178 3 infC Translation initiation factor IF-3 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q1J7B8 8.04e-46 151 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus pyogenes serotype M4 (strain MGAS10750)
A9F8E5 1.41e-45 152 48 1 164 3 infC Translation initiation factor IF-3 Sorangium cellulosum (strain So ce56)
P51231 1.77e-45 150 42 2 177 3 infC Translation initiation factor IF-3, chloroplastic Porphyra purpurea
B2RZQ1 3.33e-45 150 40 1 166 3 infC Translation initiation factor IF-3 Borrelia hermsii (strain HS1 / DAH)
Q0C535 3.53e-45 150 53 1 164 3 infC Translation initiation factor IF-3 Hyphomonas neptunium (strain ATCC 15444)
Q8AAP1 3.56e-45 150 48 2 166 3 infC Translation initiation factor IF-3 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B0JKQ1 3.9e-45 149 48 1 165 3 infC Translation initiation factor IF-3 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q64VP1 6.12e-45 150 48 2 166 3 infC Translation initiation factor IF-3 Bacteroides fragilis (strain YCH46)
Q5LEQ5 6.12e-45 150 48 2 166 3 infC Translation initiation factor IF-3 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B0CD77 9.91e-45 148 46 2 174 3 infC Translation initiation factor IF-3 Acaryochloris marina (strain MBIC 11017)
B7JYL4 1.14e-44 148 47 2 176 3 infC Translation initiation factor IF-3 Rippkaea orientalis (strain PCC 8801 / RF-1)
B5RR09 2.36e-44 148 40 1 166 3 infC Translation initiation factor IF-3 Borrelia recurrentis (strain A1)
B5RL16 2.36e-44 148 40 1 166 3 infC Translation initiation factor IF-3 Borrelia duttonii (strain Ly)
Q83GT2 2.78e-44 147 45 1 164 3 infC Translation initiation factor IF-3 Tropheryma whipplei (strain Twist)
Q83HH0 2.78e-44 147 45 1 164 3 infC Translation initiation factor IF-3 Tropheryma whipplei (strain TW08/27)
Q9CEJ7 5.56e-44 147 48 2 172 3 infC Translation initiation factor IF-3 Lactococcus lactis subsp. lactis (strain IL1403)
Q9RSN7 7.43e-44 147 43 0 157 3 infC Translation initiation factor IF-3 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8DV22 1.35e-43 145 51 1 162 3 infC Translation initiation factor IF-3 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q891T1 2.95e-43 144 49 2 165 3 infC Translation initiation factor IF-3 Clostridium tetani (strain Massachusetts / E88)
Q7V9N2 7.17e-43 144 49 2 167 3 infC Translation initiation factor IF-3 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A2C586 7.96e-43 144 49 2 167 3 infC Translation initiation factor IF-3 Prochlorococcus marinus (strain NATL1A)
Q7UJ17 1.48e-42 143 47 2 165 3 infC Translation initiation factor IF-3 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q6B8N5 1.51e-42 143 46 1 164 3 infC Translation initiation factor IF-3, chloroplastic Gracilaria tenuistipitata var. liui
Q7UA08 1.76e-42 144 49 2 167 3 infC Translation initiation factor IF-3 Parasynechococcus marenigrum (strain WH8102)
Q97GK5 1.79e-42 142 46 1 164 3 infC Translation initiation factor IF-3 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q02D92 2.23e-42 144 41 3 181 3 infC Translation initiation factor IF-3 Solibacter usitatus (strain Ellin6076)
A5GQ34 3.76e-42 143 49 2 167 3 infC Translation initiation factor IF-3 Synechococcus sp. (strain RCC307)
Q46IH3 3.97e-42 142 49 2 167 3 infC Translation initiation factor IF-3 Prochlorococcus marinus (strain NATL2A)
Q8R5Y3 6.25e-42 142 43 1 166 3 infC Translation initiation factor IF-3 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A9BD81 9.98e-42 142 47 2 167 3 infC Translation initiation factor IF-3 Prochlorococcus marinus (strain MIT 9211)
B0SKZ7 3.84e-41 139 48 3 164 3 infC Translation initiation factor IF-3 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SCH4 3.84e-41 139 48 3 164 3 infC Translation initiation factor IF-3 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A2C600 4.09e-41 140 47 2 167 3 infC Translation initiation factor IF-3 Prochlorococcus marinus (strain MIT 9303)
Q7TV76 4.61e-41 140 47 2 167 3 infC Translation initiation factor IF-3 Prochlorococcus marinus (strain MIT 9313)
Q0IDZ5 5.13e-41 140 49 2 167 3 infC Translation initiation factor IF-3 Synechococcus sp. (strain CC9311)
Q9X1S6 1.21e-40 138 46 2 162 3 infC Translation initiation factor IF-3 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q3B0M2 1.65e-40 139 48 2 167 3 infC Translation initiation factor IF-3 Synechococcus sp. (strain CC9902)
Q3ANG8 2.31e-40 139 47 2 167 3 infC Translation initiation factor IF-3 Synechococcus sp. (strain CC9605)
A5GI06 9.7e-40 137 47 2 167 3 infC Translation initiation factor IF-3 Synechococcus sp. (strain WH7803)
Q7TU24 1.27e-39 136 46 2 167 3 infC Translation initiation factor IF-3 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
A2BZ21 1.74e-39 135 46 2 167 3 infC Translation initiation factor IF-3 Prochlorococcus marinus (strain MIT 9515)
Q7VJ08 5.39e-39 134 44 1 165 3 infC Translation initiation factor IF-3 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q9TLX8 6.86e-39 134 41 1 163 3 infC Translation initiation factor IF-3, chloroplastic Cyanidium caldarium
Q7MVQ6 7.15e-39 134 46 2 170 3 infC Translation initiation factor IF-3 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RJD7 9.18e-39 134 46 2 170 3 infC Translation initiation factor IF-3 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
A3PFC5 1.02e-38 134 45 2 167 3 infC Translation initiation factor IF-3 Prochlorococcus marinus (strain MIT 9301)
A6L9S3 1.16e-38 134 48 2 165 3 infC Translation initiation factor IF-3 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q318A5 2.31e-38 132 44 2 167 3 infC Translation initiation factor IF-3 Prochlorococcus marinus (strain MIT 9312)
A6Q167 2.96e-38 132 47 1 164 3 infC Translation initiation factor IF-3 Nitratiruptor sp. (strain SB155-2)
Q8F6Q9 4.54e-38 131 45 3 166 3 infC Translation initiation factor IF-3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PK8 4.54e-38 131 45 3 166 3 infC Translation initiation factor IF-3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A2BTL8 4.94e-38 132 44 2 167 3 infC Translation initiation factor IF-3 Prochlorococcus marinus (strain AS9601)
A8G7E2 7.3e-38 131 44 2 167 3 infC Translation initiation factor IF-3 Prochlorococcus marinus (strain MIT 9215)
Q04ZG9 7.89e-38 131 46 3 166 3 infC Translation initiation factor IF-3 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04U56 7.89e-38 131 46 3 166 3 infC Translation initiation factor IF-3 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B6YQ94 6.16e-37 129 48 2 165 3 infC Translation initiation factor IF-3 Azobacteroides pseudotrichonymphae genomovar. CFP2
Q9MS97 7.54e-35 123 40 1 164 3 infC Translation initiation factor IF-3, chloroplastic Galdieria sulphuraria
Q5H9Z3 8.16e-35 123 42 3 169 3 infC Translation initiation factor IF-3 Ehrlichia ruminantium (strain Welgevonden)
Q5FGP0 8.16e-35 123 42 3 169 3 infC Translation initiation factor IF-3 Ehrlichia ruminantium (strain Gardel)
Q30UI3 1.52e-34 122 42 1 164 3 infC Translation initiation factor IF-3 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B4S3D1 1.6e-34 123 37 2 166 3 infC Translation initiation factor IF-3 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q85G77 2.97e-34 122 36 2 165 3 infC Translation initiation factor IF-3, chloroplastic Cyanidioschyzon merolae (strain NIES-3377 / 10D)
B3EKG8 3.32e-34 122 36 2 166 3 infC Translation initiation factor IF-3 Chlorobium phaeobacteroides (strain BS1)
B1GZU2 3.57e-34 122 41 1 169 3 infC Translation initiation factor IF-3 Endomicrobium trichonymphae
A0RRI8 7.08e-34 120 43 1 164 3 infC Translation initiation factor IF-3 Campylobacter fetus subsp. fetus (strain 82-40)
A7I108 8.84e-34 120 42 0 164 3 infC Translation initiation factor IF-3 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A7GVZ3 9.38e-34 120 42 1 164 3 infC Translation initiation factor IF-3 Campylobacter curvus (strain 525.92)
Q2GI91 1.07e-33 120 41 1 168 3 infC Translation initiation factor IF-3 Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
B3DYI1 5.1e-33 120 38 2 163 3 infC Translation initiation factor IF-3 Methylacidiphilum infernorum (isolate V4)
Q8KAM9 6.65e-32 117 38 2 166 3 infC Translation initiation factor IF-3 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B9KEB2 7.71e-32 115 43 1 165 3 infC Translation initiation factor IF-3 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A7ZAZ8 2.05e-31 114 42 1 164 3 infC Translation initiation factor IF-3 Campylobacter concisus (strain 13826)
Q5HWW2 2.34e-31 114 42 1 164 1 infC Translation initiation factor IF-3 Campylobacter jejuni (strain RM1221)
A1VXT6 2.34e-31 114 42 1 164 3 infC Translation initiation factor IF-3 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PIS2 2.34e-31 114 42 1 164 3 infC Translation initiation factor IF-3 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FK08 2.34e-31 114 42 1 164 3 infC Translation initiation factor IF-3 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A7H1S1 4.61e-31 113 42 1 164 3 infC Translation initiation factor IF-3 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q6F1S8 1.23e-30 112 37 2 165 3 infC Translation initiation factor IF-3 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
B3QRM3 1.24e-30 113 36 3 173 3 infC Translation initiation factor IF-3 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B2KB83 2.88e-30 111 40 1 164 3 infC Translation initiation factor IF-3 Elusimicrobium minutum (strain Pei191)
O82234 6.06e-30 114 40 1 162 2 IF3-2 Translation initiation factor IF3-2, chloroplastic Arabidopsis thaliana
Q7M9L9 2.64e-29 109 45 1 165 3 infC Translation initiation factor IF-3 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q94B52 4.91e-29 111 39 1 163 2 IF3-4 Translation initiation factor IF3-4, chloroplastic Arabidopsis thaliana
Q3APW0 4.62e-28 107 37 3 177 3 infC Translation initiation factor IF-3 Chlorobium chlorochromatii (strain CaD3)
A4SCK3 1.3e-27 105 37 2 166 3 infC Translation initiation factor IF-3 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q3B6L9 1.33e-27 105 37 2 166 3 infC Translation initiation factor IF-3 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q05426 4.82e-27 104 38 2 176 3 infC Translation initiation factor IF-3 Mycoplasmopsis fermentans
B3EEC0 5.27e-27 104 37 2 166 3 infC Translation initiation factor IF-3 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A1BJB3 1.86e-26 102 37 2 166 3 infC Translation initiation factor IF-3 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B9L5U8 2.36e-26 101 43 3 167 3 infC Translation initiation factor IF-3 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
P55973 4.8e-25 99 41 1 165 3 infC Translation initiation factor IF-3 Helicobacter pylori (strain ATCC 700392 / 26695)
Q8YUH8 4.94e-25 97 31 2 162 3 all2368 Translation initiation factor IF-3-like Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9ZMV2 5.69e-25 99 41 1 165 1 infC Translation initiation factor IF-3 Helicobacter pylori (strain J99 / ATCC 700824)
Q2SSS1 4.06e-23 93 31 3 178 3 infC Translation initiation factor IF-3 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q98QV2 4.79e-23 94 36 2 166 3 infC Translation initiation factor IF-3 Mycoplasmopsis pulmonis (strain UAB CTIP)
P36177 6.12e-23 97 36 2 166 1 None Translation initiation factor IF-3, chloroplastic Euglena gracilis
Q6MU22 6.5e-23 92 31 3 178 3 infC Translation initiation factor IF-3 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
P47438 7.01e-18 80 28 1 142 3 infC Translation initiation factor IF-3 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9PQR4 2.85e-16 75 31 1 172 3 infC Translation initiation factor IF-3 Ureaplasma parvum serovar 3 (strain ATCC 700970)
P78024 7.26e-16 75 29 1 152 3 infC Translation initiation factor IF-3 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q6NLP2 2.93e-13 70 36 2 117 2 IF3-1 Translation initiation factor IF3-1, mitochondrial Arabidopsis thaliana
Q76PC7 0.000439 43 26 5 147 3 SPBC18E5.13 Probable translation initiation factor, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03340
Feature type CDS
Gene infC
Product translation initiation factor IF-3
Location 713347 - 713886 (strand: 1)
Length 540 (nucleotides) / 179 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1810
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00707 Translation initiation factor IF-3, C-terminal domain
PF05198 Translation initiation factor IF-3, N-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0290 Translation, ribosomal structure and biogenesis (J) J Translation initiation factor IF-3

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02520 translation initiation factor IF-3 - -

Protein Sequence

MKGGKRIQTARPNRINSEIRVTELRLTGLEGEQLGIVSLKEALEKAEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKSTKEQKKKQKVIQVKEIKFRPGTDEGDYQVKLRNLIRFLEDGDKAKITLRFRGREMAHQQIGLEVLNRVKDDLSEIASVESFPSRIEGRQMIMVLAPKKK

Flanking regions ( +/- flanking 50bp)

TGCTTGAAGAAATTCGCAGTCGCAGTCTTGATCAACTGGAGGAATAAAGTATTAAAGGCGGAAAAAGAATCCAAACGGCACGTCCGAACCGTATCAACTCGGAGATTCGTGTCACTGAATTACGTTTGACTGGCTTGGAAGGCGAACAACTTGGTATTGTCAGCCTTAAAGAAGCTCTTGAGAAAGCCGAGGAAGCAGGGGTTGATTTAGTTGAAATCAGTCCTAATGCCGAGCCGCCGGTTTGTCGGATTATGGATTACGGCAAATTCCTCTACGAAAAGAGCAAATCGACAAAAGAACAGAAAAAGAAACAAAAAGTTATTCAGGTCAAGGAAATTAAATTCCGTCCTGGTACAGATGAAGGCGACTATCAGGTCAAACTACGCAACCTGATTCGTTTTCTTGAAGATGGTGACAAAGCCAAAATCACACTGCGGTTCCGTGGTCGTGAAATGGCGCACCAGCAGATCGGTCTTGAAGTACTTAACCGTGTTAAAGACGATCTGAGTGAAATCGCGTCCGTCGAATCGTTTCCATCACGAATCGAAGGTCGTCAGATGATCATGGTGCTTGCGCCTAAGAAGAAATAGTCGGGCAATAACAAGTAATAAGCGCCGGGGGCAACCCCGGTACTTATTCG