Homologs in group_406

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16410 FBDBKF_16410 94.5 Morganella morganii S1 araC AraC-type DNA-binding domain and AraC-containing proteins
EHELCC_08275 EHELCC_08275 94.5 Morganella morganii S2 araC AraC-type DNA-binding domain and AraC-containing proteins
NLDBIP_08600 NLDBIP_08600 94.5 Morganella morganii S4 araC AraC-type DNA-binding domain and AraC-containing proteins
LHKJJB_05665 LHKJJB_05665 94.5 Morganella morganii S3 araC AraC-type DNA-binding domain and AraC-containing proteins
HKOGLL_05250 HKOGLL_05250 94.5 Morganella morganii S5 araC AraC-type DNA-binding domain and AraC-containing proteins
PMI_RS06165 PMI_RS06165 33.6 Proteus mirabilis HI4320 - XylR family transcriptional regulator
PMI_RS07795 PMI_RS07795 78.7 Proteus mirabilis HI4320 - helix-turn-helix domain-containing protein

Distribution of the homologs in the orthogroup group_406

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_406

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q56143 1.1e-27 101 43 0 103 3 soxS Regulatory protein SoxS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A9E2 1.38e-26 98 42 0 103 1 soxS Regulatory protein SoxS Escherichia coli (strain K12)
P0A9E3 1.38e-26 98 42 0 103 3 soxS Regulatory protein SoxS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9E4 1.38e-26 98 42 0 103 3 soxS Regulatory protein SoxS Escherichia coli O157:H7
Q52620 4.12e-26 97 43 1 103 4 pqrA Probable transcription factor PqrA Proteus vulgaris
P0ACI2 1.81e-24 97 42 0 107 3 rob Right origin-binding protein Shigella flexneri
P0ACI0 1.81e-24 97 42 0 107 1 rob Right origin-binding protein Escherichia coli (strain K12)
P0ACI1 1.81e-24 97 42 0 107 3 rob Right origin-binding protein Escherichia coli O157:H7
Q8ZJU7 1.9e-23 94 41 0 107 2 rob Transcriptional regulator Rob Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P28816 2.48e-23 90 38 0 110 1 tetD Transposon Tn10 TetD protein Escherichia coli
H9L484 2.84e-22 87 35 0 100 1 ramA Transcriptional regulator RamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q48413 3.72e-22 87 37 0 100 1 ramA Transcriptional activator RamA Klebsiella pneumoniae
A0A0H3GPK2 3.72e-22 87 37 0 100 1 ramA Transcriptional regulator RamA Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P55922 1.55e-20 83 35 0 101 4 ramA Transcriptional activator RamA Enterobacter cloacae
P43463 9.73e-20 81 35 0 100 4 aarP HTH-type transcriptional activator AarP Providencia stuartii
P0ACH7 1.79e-18 78 35 0 98 3 marA Multiple antibiotic resistance protein MarA Shigella flexneri
P0ACH5 1.79e-18 78 35 0 98 1 marA Multiple antibiotic resistance protein MarA Escherichia coli (strain K12)
P0ACH6 1.79e-18 78 35 0 98 3 marA Multiple antibiotic resistance protein MarA Escherichia coli O157:H7
P0A2S4 2.45e-18 77 35 0 98 2 marA Multiple antibiotic resistance protein MarA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2S5 2.45e-18 77 35 0 98 3 marA Multiple antibiotic resistance protein MarA Salmonella typhi
P0A2S6 2.45e-18 77 35 0 98 3 marA Multiple antibiotic resistance protein MarA Salmonella enteritidis
P77601 1.14e-15 73 37 0 95 5 ykgA Putative HTH-type transcriptional regulator YkgA Escherichia coli (strain K12)
B5XZ49 6.13e-15 72 35 0 104 3 rhaS HTH-type transcriptional activator RhaS Klebsiella pneumoniae (strain 342)
A6TGA9 1.15e-14 71 35 0 104 3 rhaS HTH-type transcriptional activator RhaS Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8AL27 5.51e-13 66 32 0 104 3 rhaS HTH-type transcriptional activator RhaS Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7ZUB7 1.41e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O139:H28 (strain E24377A / ETEC)
B5FPP5 1.68e-12 65 32 0 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella dublin (strain CT_02021853)
B5BJG8 1.92e-12 65 32 0 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi A (strain AKU_12601)
Q5PKG2 1.92e-12 65 32 0 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P0A2S9 1.94e-12 65 32 0 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2T0 1.94e-12 65 32 0 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella typhi
C0Q3L4 1.94e-12 65 32 0 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi C (strain RKS4594)
A9MZC8 1.94e-12 65 32 0 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SZZ3 1.94e-12 65 32 0 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella newport (strain SL254)
B5RFC3 1.94e-12 65 32 0 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QWY4 1.94e-12 65 32 0 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella enteritidis PT4 (strain P125109)
B4TBY3 1.98e-12 65 32 0 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella heidelberg (strain SL476)
B5F0M9 2.08e-12 65 32 0 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella agona (strain SL483)
Q1R414 2.1e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain UTI89 / UPEC)
B7NFK3 2.1e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A1AI82 2.1e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O1:K1 / APEC
B7NUA1 2.1e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MI37 2.1e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O45:K1 (strain S88 / ExPEC)
A4WG91 2.14e-12 65 29 0 111 3 rhaS HTH-type transcriptional activator RhaS Enterobacter sp. (strain 638)
Q83PE0 2.16e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Shigella flexneri
Q0SZ95 2.16e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Shigella flexneri serotype 5b (strain 8401)
B6I4P8 2.19e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain SE11)
B1LMU6 2.23e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain SMS-3-5 / SECEC)
Q0TAF8 2.44e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UNM6 2.44e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q32A70 2.47e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Shigella dysenteriae serotype 1 (strain Sd197)
Q8CXW5 2.49e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B5YZ43 2.52e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X897 2.52e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O157:H7
Q31U84 2.62e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Shigella boydii serotype 4 (strain Sb227)
P09377 2.62e-12 65 31 0 105 1 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12)
B1IVH3 2.62e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A709 2.62e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O9:H4 (strain HS)
B1XB72 2.62e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12 / DH10B)
C5A073 2.62e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6V7 2.62e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O8 (strain IAI1)
B7L9G1 2.62e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain 55989 / EAEC)
B7N2P7 2.65e-12 65 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O81 (strain ED1a)
Q3YV71 2.68e-12 64 31 0 105 3 rhaS HTH-type transcriptional activator RhaS Shigella sonnei (strain Ss046)
P45008 3.19e-12 64 31 2 110 4 HI_1052 Uncharacterized HTH-type transcriptional regulator HI_1052 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B4TPQ9 3.74e-12 64 32 0 104 3 rhaS HTH-type transcriptional activator RhaS Salmonella schwarzengrund (strain CVM19633)
Q57HG8 5.65e-12 63 32 0 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella choleraesuis (strain SC-B67)
A9MI64 5.82e-12 63 32 0 101 3 rhaS HTH-type transcriptional activator RhaS Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q05587 1.9e-11 62 31 0 94 1 pocR Regulatory protein PocR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B2TVP7 2.05e-11 62 30 0 105 3 rhaS HTH-type transcriptional activator RhaS Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P19219 2.11e-11 61 31 0 101 1 adaA Bifunctional transcriptional activator/DNA repair enzyme AdaA Bacillus subtilis (strain 168)
P96662 3.61e-11 62 35 0 95 4 ydeE Uncharacterized HTH-type transcriptional regulator YdeE Bacillus subtilis (strain 168)
Q6GD21 4.94e-11 62 32 2 126 4 SAS0078 Uncharacterized HTH-type transcriptional regulator SAS0078 Staphylococcus aureus (strain MSSA476)
Q8NYT6 4.94e-11 62 32 2 126 4 MW0077 Uncharacterized HTH-type transcriptional regulator MW0077 Staphylococcus aureus (strain MW2)
Q99XB1 4.98e-11 62 32 2 126 4 SAV0101 Uncharacterized HTH-type transcriptional regulator SAV0101 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A882 4.98e-11 62 32 2 126 4 SA0097 Uncharacterized HTH-type transcriptional regulator SA0097 Staphylococcus aureus (strain N315)
Q6GKK1 5.18e-11 62 32 2 126 4 SAR0107 Uncharacterized HTH-type transcriptional regulator SAR0107 Staphylococcus aureus (strain MRSA252)
Q5HJR8 7e-11 61 32 2 126 4 SACOL0084 Uncharacterized HTH-type transcriptional regulator SACOL0084 Staphylococcus aureus (strain COL)
B7LVD8 7.88e-11 60 28 0 111 3 rhaS HTH-type transcriptional activator RhaS Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q65Q31 2.37e-10 59 33 0 93 3 rhaS HTH-type transcriptional activator RhaS Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q66FF1 2.38e-10 59 41 0 68 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FN79 2.38e-10 59 41 0 68 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JNC4 2.47e-10 59 41 0 68 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TRS7 2.5e-10 59 41 0 68 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis (strain Pestoides F)
Q1CEB6 2.5e-10 59 41 0 68 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYR6 2.5e-10 59 41 0 68 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIZ9 2.5e-10 59 41 0 68 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis
B2K1W6 2.5e-10 59 41 0 68 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0W2 2.5e-10 59 41 0 68 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Antiqua)
Q936F1 4.45e-10 59 30 2 126 4 None Uncharacterized HTH-type transcriptional regulator Staphylococcus aureus
Q9WW32 1.25e-09 57 23 1 117 1 mtrA HTH-type transcriptional regulator MtrA Neisseria gonorrhoeae
O31456 1.75e-09 57 42 0 92 3 ybfP Uncharacterized HTH-type transcriptional regulator YbfP Bacillus subtilis (strain 168)
P26950 3.63e-09 56 38 0 93 4 caf1R F1 operon positive regulatory protein Yersinia pestis
O31449 4.83e-09 55 29 2 110 4 ybfI Uncharacterized HTH-type transcriptional regulator YbfI Bacillus subtilis (strain 168)
P26993 8.52e-09 55 32 0 99 1 exsA HTH-type transcriptional regulator ExsA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
C6DJR5 9.63e-09 55 38 0 73 3 rhaR HTH-type transcriptional activator RhaR Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A9QYR8 1.07e-08 55 29 0 95 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Angola)
B1JNC5 1.13e-08 54 29 0 95 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TRS8 1.13e-08 54 29 0 95 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis (strain Pestoides F)
B2K1W5 1.13e-08 54 29 0 95 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FN80 1.13e-08 54 29 0 95 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66FF2 1.18e-08 54 29 0 95 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype I (strain IP32953)
Q6DA21 1.31e-08 54 36 0 73 3 rhaR HTH-type transcriptional activator RhaR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JU91 4.36e-08 53 33 0 95 3 virF Virulence regulon transcriptional activator VirF Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P0C2V5 4.45e-08 53 33 0 95 2 virF Virulence regulon transcriptional activator VirF Yersinia enterocolitica
P28808 4.77e-08 53 33 0 95 4 lcrF Thermoregulatory protein LcrF Yersinia pestis
Q65Q30 5.26e-08 53 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q47129 6.95e-08 52 29 2 88 1 feaR Transcriptional activator FeaR Escherichia coli (strain K12)
Q1CEB5 8.27e-08 52 28 0 95 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZJ00 8.27e-08 52 28 0 95 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis
Q1C0W1 8.27e-08 52 28 0 95 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Antiqua)
Q8ZM00 1.62e-07 51 32 1 96 1 STM3175 Probable HTH-type transcriptional regulator STM3175 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A6TGB0 2.58e-07 51 30 0 86 3 rhaR HTH-type transcriptional activator RhaR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q9HTI4 4.18e-07 50 31 0 85 1 gbdR HTH-type transcriptional regulator GbdR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A0H2ZIC3 4.18e-07 50 31 0 85 1 gbdR HTH-type transcriptional regulator GbdR Pseudomonas aeruginosa (strain UCBPP-PA14)
O87389 4.73e-07 50 31 1 104 4 glxA HTH-type transcriptional regulator GlxA Rhizobium meliloti (strain 1021)
A7ML57 6.89e-07 49 32 0 68 3 rhaR HTH-type transcriptional activator RhaR Cronobacter sakazakii (strain ATCC BAA-894)
P77396 2.05e-06 48 23 0 95 4 ypdC Uncharacterized HTH-type transcriptional regulator YpdC Escherichia coli (strain K12)
P35319 2.94e-06 48 27 1 105 4 None Putative AraC-like transcription regulator Streptomyces lividans
P0ACI3 3.05e-06 48 30 1 100 1 xylR Xylose operon regulatory protein Escherichia coli (strain K12)
P0ACI4 3.05e-06 48 30 1 100 3 xylR Xylose operon regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACI5 3.05e-06 48 30 1 100 3 xylR Xylose operon regulatory protein Escherichia coli O157:H7
P77379 1.33e-05 46 28 0 88 1 rclR RCS-specific HTH-type transcriptional activator RclR Escherichia coli (strain K12)
Q32A71 1.52e-05 45 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Shigella dysenteriae serotype 1 (strain Sd197)
Q1R413 1.7e-05 45 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain UTI89 / UPEC)
A1AI83 1.7e-05 45 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O1:K1 / APEC
Q31U83 1.73e-05 45 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Shigella boydii serotype 4 (strain Sb227)
Q8FBD7 1.73e-05 45 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAF7 1.73e-05 45 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZUB8 1.73e-05 45 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83PD9 1.76e-05 45 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Shigella flexneri
Q0SZ96 1.76e-05 45 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Shigella flexneri serotype 5b (strain 8401)
P09378 1.76e-05 45 29 0 67 1 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain K12)
A8A710 1.76e-05 45 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O9:H4 (strain HS)
C5A074 1.76e-05 45 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain K12 / MC4100 / BW2952)
P07642 1.76e-05 45 25 0 84 3 araC Arabinose operon regulatory protein Dickeya chrysanthemi
Q8X7B3 1.85e-05 45 29 0 67 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O157:H7
P96660 2.19e-05 45 25 0 93 4 ydeC Uncharacterized HTH-type transcriptional regulator YdeC Bacillus subtilis (strain 168)
Q02458 2.2e-05 45 30 3 100 1 ureR Urease operon transcriptional activator Proteus mirabilis (strain HI4320)
P40408 2.35e-05 45 27 0 91 1 btr HTH-type transcriptional activator Btr Bacillus subtilis (strain 168)
P32326 3.62e-05 45 26 1 96 4 ureR Urease operon transcriptional activator Escherichia coli
O31522 4.72e-05 44 29 1 84 2 yesS HTH-type transcriptional regulator YesS Bacillus subtilis (strain 168)
B1Q2A8 4.84e-05 44 30 1 84 1 nphR Transcriptional activator NphR Rhodococcus sp.
O32071 5.41e-05 44 30 0 84 4 ytdP Uncharacterized HTH-type transcriptional regulator YtdP Bacillus subtilis (strain 168)
P07859 6.2e-05 44 30 1 94 4 xylS XylDLEGF operon transcriptional activator Pseudomonas putida
Q04710 6.9e-05 44 30 1 94 4 xylS1 XylDLEGF operon transcriptional activator 1 Pseudomonas putida
P95283 7.24e-05 43 28 0 82 2 Rv1931c HTH-type transcriptional regulator Rv1931c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P0ACH8 7.98e-05 43 25 0 99 1 melR Melibiose operon regulatory protein Escherichia coli (strain K12)
P0ACH9 7.98e-05 43 25 0 99 3 melR Melibiose operon regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q03320 0.000104 43 24 0 102 4 None Putative AraC-like transcription regulator Streptomyces antibioticus
Q05092 0.000143 42 28 1 94 4 xylS2 XylDLEGF operon transcriptional activator 2 Pseudomonas putida
P40883 0.000227 42 32 1 81 2 pchR Regulatory protein PchR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q46855 0.000304 42 26 0 101 4 yqhC Uncharacterized HTH-type transcriptional regulator YqhC Escherichia coli (strain K12)
G3XCU2 0.00046 42 28 0 80 4 argR HTH-type transcriptional regulator ArgR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q00753 0.000736 41 23 0 101 4 msmR Msm operon regulatory protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS02930
Feature type CDS
Gene -
Product helix-turn-helix domain-containing protein
Location 622208 - 622591 (strand: -1)
Length 384 (nucleotides) / 127 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_406
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF12833 Helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2207 Transcription (K) K AraC-type DNA-binding domain and AraC-containing proteins

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K13631 AraC family transcriptional regulator, mar-sox-rob regulon activator - -

Protein Sequence

MLQDNHIALVCALSKWIENHPGRVIHLEELAAYSGYSLWHMQKIFKEVAGISLGKYIRQRRLAGAVTALRRSEQTIFDIALDFGFGSQSHFTYMFRKEYNITPYDYRQNPEIELDIKEPWHFTHDCN

Flanking regions ( +/- flanking 50bp)

TGAAATAAACTTGTATACTTGAAAAACCCTGAAACTGAGTCGAAATCGTAATGCTGCAAGATAATCATATAGCACTGGTGTGCGCCCTTAGTAAGTGGATAGAAAACCATCCGGGTCGCGTTATCCATCTTGAAGAGCTCGCTGCCTATTCTGGGTACTCCCTCTGGCACATGCAGAAAATCTTCAAAGAAGTTGCCGGCATTTCTCTCGGCAAATATATTCGTCAGCGCCGTCTTGCCGGTGCGGTCACTGCTTTGCGCCGCAGTGAACAGACTATCTTTGATATCGCACTGGATTTCGGTTTCGGGTCGCAATCTCACTTCACCTATATGTTCCGCAAAGAATATAACATCACCCCCTACGACTACCGCCAGAATCCTGAGATTGAGCTGGATATCAAAGAGCCCTGGCATTTCACTCACGACTGTAACTAAGGCAACTTAAACAATTAATAACAGAATTATATTTAGTTATATGATTTTGG