Homologs in group_3684

Help

2 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS02265 F4V73_RS02265 27.9 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
PMI_RS10875 PMI_RS10875 38.6 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_3684

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3684

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45902 1.02e-05 43 37 0 53 4 yqaE Uncharacterized HTH-type transcriptional regulator YqaE Bacillus subtilis (strain 168)
Q92HV3 7.22e-05 41 32 0 77 4 RC0668 Uncharacterized HTH-type transcriptional regulator RC0668 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9ZD50 0.000241 40 31 0 77 4 RP497 Uncharacterized HTH-type transcriptional regulator RP497 Rickettsia prowazekii (strain Madrid E)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01640
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 360560 - 360829 (strand: 1)
Length 270 (nucleotides) / 89 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3684
Orthogroup size 3
N. genomes 2

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MTSIDEIKDNISVIIRKRIFDKRKEKHLSGREVAALLGVSQQQYSCYERGISRIDIVTLVNISIIFRTNINWFLKDIISLCDQEGILKS

Flanking regions ( +/- flanking 50bp)

GATCTCTTCTGTTGTAATATTAAATATATACCTCTCCGGGGTTATTTAGCATGACCAGTATCGATGAAATAAAAGATAATATAAGTGTGATAATAAGAAAGCGTATATTTGATAAACGAAAGGAAAAACATTTATCAGGGCGGGAGGTTGCTGCACTTCTCGGCGTCAGCCAGCAGCAGTACTCTTGTTATGAGCGTGGAATCAGTCGTATTGATATTGTTACTTTAGTAAATATATCAATTATATTCCGAACTAATATTAATTGGTTTTTAAAAGACATTATATCTCTTTGTGATCAGGAAGGTATATTAAAATCCTGATCGACAAAATTTTATTTTTTTAATTTATTAAATATCAAGAGTCAATATTT