Homologs in group_151

Help

9 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04630 FBDBKF_04630 38.9 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_05920 EHELCC_05920 38.9 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_06240 NLDBIP_06240 38.9 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_03120 LHKJJB_03120 38.9 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_06595 HKOGLL_06595 38.9 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS02265 F4V73_RS02265 28.6 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS08420 F4V73_RS08420 35.3 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS09080 F4V73_RS09080 36.1 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS10915 F4V73_RS10915 27.6 Morganella psychrotolerans - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_151

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_151

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45902 1.02e-05 43 37 0 53 4 yqaE Uncharacterized HTH-type transcriptional regulator YqaE Bacillus subtilis (strain 168)
Q92HV3 7.22e-05 41 32 0 77 4 RC0668 Uncharacterized HTH-type transcriptional regulator RC0668 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9ZD50 0.000241 40 31 0 77 4 RP497 Uncharacterized HTH-type transcriptional regulator RP497 Rickettsia prowazekii (strain Madrid E)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01640
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 360560 - 360829 (strand: 1)
Length 270 (nucleotides) / 89 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_151
Orthogroup size 10
N. genomes 6

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MTSIDEIKDNISVIIRKRIFDKRKEKHLSGREVAALLGVSQQQYSCYERGISRIDIVTLVNISIIFRTNINWFLKDIISLCDQEGILKS

Flanking regions ( +/- flanking 50bp)

GATCTCTTCTGTTGTAATATTAAATATATACCTCTCCGGGGTTATTTAGCATGACCAGTATCGATGAAATAAAAGATAATATAAGTGTGATAATAAGAAAGCGTATATTTGATAAACGAAAGGAAAAACATTTATCAGGGCGGGAGGTTGCTGCACTTCTCGGCGTCAGCCAGCAGCAGTACTCTTGTTATGAGCGTGGAATCAGTCGTATTGATATTGTTACTTTAGTAAATATATCAATTATATTCCGAACTAATATTAATTGGTTTTTAAAAGACATTATATCTCTTTGTGATCAGGAAGGTATATTAAAATCCTGATCGACAAAATTTTATTTTTTTAATTTATTAAATATCAAGAGTCAATATTT