Homologs in group_1197

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06915 FBDBKF_06915 93.2 Morganella morganii S1 hisB bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB
EHELCC_04055 EHELCC_04055 93.2 Morganella morganii S2 hisB bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB
NLDBIP_04055 NLDBIP_04055 93.2 Morganella morganii S4 hisB bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB
LHKJJB_09885 LHKJJB_09885 93.2 Morganella morganii S3 hisB bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB
HKOGLL_09090 HKOGLL_09090 93.2 Morganella morganii S5 hisB bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB
PMI_RS03260 PMI_RS03260 77.2 Proteus mirabilis HI4320 hisB bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB

Distribution of the homologs in the orthogroup group_1197

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1197

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P06987 0.0 598 79 0 355 1 hisB Histidine biosynthesis bifunctional protein HisB Escherichia coli (strain K12)
Q9S5G5 0.0 596 79 0 355 1 hisB Histidine biosynthesis bifunctional protein HisB Escherichia coli O157:H7
Q83R05 0.0 594 79 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Shigella flexneri
Q8FG50 0.0 593 78 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P10368 0.0 593 78 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PDP5 0.0 593 78 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z5J8 0.0 590 78 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Salmonella typhi
Q8ZFX7 0.0 581 75 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Yersinia pestis
Q66C51 0.0 579 75 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Yersinia pseudotuberculosis serotype I (strain IP32953)
Q7N6I2 0.0 578 76 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TBC5 0.0 578 76 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q6D409 0.0 572 75 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NTX3 0.0 564 74 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Sodalis glossinidius (strain morsitans)
Q7MLS4 0.0 508 68 0 353 3 hisB Histidine biosynthesis bifunctional protein HisB Vibrio vulnificus (strain YJ016)
Q8D8Q2 2.69e-180 506 68 0 353 3 hisB Histidine biosynthesis bifunctional protein HisB Vibrio vulnificus (strain CMCP6)
Q1LT69 1.1e-179 504 66 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Baumannia cicadellinicola subsp. Homalodisca coagulata
P57920 3.92e-179 503 66 2 361 3 hisB Histidine biosynthesis bifunctional protein HisB Pasteurella multocida (strain Pm70)
Q87QK9 1.65e-178 502 67 0 353 3 hisB Histidine biosynthesis bifunctional protein HisB Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B0BU51 5.05e-178 501 65 2 362 3 hisB Histidine biosynthesis bifunctional protein HisB Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q9KSX1 6.41e-178 500 68 0 353 3 hisB Histidine biosynthesis bifunctional protein HisB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A3N3W1 1.02e-177 500 65 2 364 3 hisB Histidine biosynthesis bifunctional protein HisB Actinobacillus pleuropneumoniae serotype 5b (strain L20)
P62455 1.32e-177 499 66 1 358 3 hisB Histidine biosynthesis bifunctional protein HisB Photobacterium profundum (strain SS9)
B3GZG9 1.48e-177 499 65 2 362 3 hisB Histidine biosynthesis bifunctional protein HisB Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A6VM11 1.24e-175 494 64 2 362 3 hisB Histidine biosynthesis bifunctional protein HisB Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65RB3 7.05e-174 490 63 3 366 3 hisB Histidine biosynthesis bifunctional protein HisB Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P44327 6.34e-172 485 63 2 362 3 hisB Histidine biosynthesis bifunctional protein HisB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q15RU7 1.33e-171 484 65 0 353 3 hisB Histidine biosynthesis bifunctional protein HisB Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A5UGY3 2.69e-171 484 63 2 362 3 hisB Histidine biosynthesis bifunctional protein HisB Haemophilus influenzae (strain PittGG)
A5UA18 2.69e-171 484 63 2 362 3 hisB Histidine biosynthesis bifunctional protein HisB Haemophilus influenzae (strain PittEE)
Q4QN72 5.98e-171 483 62 2 362 3 hisB Histidine biosynthesis bifunctional protein HisB Haemophilus influenzae (strain 86-028NP)
Q8EFB3 1.77e-162 461 60 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q47XB6 3.01e-162 461 61 1 356 3 hisB Histidine biosynthesis bifunctional protein HisB Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
P59454 5.04e-155 442 57 2 357 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q7VQW8 1.65e-153 438 56 1 356 3 hisB Histidine biosynthesis bifunctional protein HisB Blochmanniella floridana
B8D708 2.45e-150 430 56 1 355 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57203 2.45e-150 430 56 1 355 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8Q4 2.45e-150 430 56 1 355 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q9ZHE4 2.72e-150 430 54 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9PM76 4.82e-150 429 56 2 355 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A1W1K1 5.26e-150 429 56 2 355 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FNR1 6.4e-150 429 56 2 355 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A7H5U9 2.62e-149 427 56 2 355 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q5HSJ2 6.78e-149 426 56 2 355 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni (strain RM1221)
B4STN9 1.38e-132 385 55 3 355 3 hisB Histidine biosynthesis bifunctional protein HisB Stenotrophomonas maltophilia (strain R551-3)
B2FPM1 3.37e-132 384 55 3 355 3 hisB Histidine biosynthesis bifunctional protein HisB Stenotrophomonas maltophilia (strain K279a)
B0RSL6 4.42e-131 382 53 4 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas campestris pv. campestris (strain B100)
Q5ZW89 2.09e-130 379 51 2 353 3 hisB Histidine biosynthesis bifunctional protein HisB Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
P58882 2.22e-130 380 53 4 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UU42 2.22e-130 380 53 4 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas campestris pv. campestris (strain 8004)
Q5WX93 2.69e-130 379 51 2 353 3 hisB Histidine biosynthesis bifunctional protein HisB Legionella pneumophila (strain Lens)
Q5X5X1 1.35e-128 375 50 2 353 3 hisB Histidine biosynthesis bifunctional protein HisB Legionella pneumophila (strain Paris)
P58881 1.14e-127 374 52 4 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas axonopodis pv. citri (strain 306)
Q5H0K9 1.68e-127 373 51 4 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SKN6 1.68e-127 373 51 4 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P3K1 1.68e-127 373 51 4 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BUF5 3.6e-126 370 51 4 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q87C31 8.57e-124 363 50 3 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5X9 8.57e-124 363 50 3 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xylella fastidiosa (strain M23)
B0U3B1 4.9e-123 362 50 3 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xylella fastidiosa (strain M12)
Q9PBC7 2.9e-122 360 50 3 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xylella fastidiosa (strain 9a5c)
Q64RE9 1.61e-113 337 46 4 375 3 hisB Histidine biosynthesis bifunctional protein HisB Bacteroides fragilis (strain YCH46)
Q5LB00 1.61e-113 337 46 4 375 3 hisB Histidine biosynthesis bifunctional protein HisB Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
D2QPE6 7e-113 336 47 4 382 1 hisB Histidine biosynthesis bifunctional protein HisB Spirosoma linguale (strain ATCC 33905 / DSM 74 / LMG 10896 / Claus 1)
Q8ABA7 6.07e-111 331 44 3 374 1 hisB Histidine biosynthesis bifunctional protein HisB Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q1GNC0 1.49e-65 209 52 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q12WC5 3.83e-64 205 51 1 190 3 hisB Imidazoleglycerol-phosphate dehydratase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
A4SF66 4.85e-63 202 47 2 200 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q8PWS1 1.14e-61 198 48 1 190 3 hisB Imidazoleglycerol-phosphate dehydratase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
B1H0E9 1.03e-60 196 50 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Endomicrobium trichonymphae
Q3AQD7 1.51e-60 196 47 2 196 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobium chlorochromatii (strain CaD3)
A5UMI3 6.02e-60 194 46 1 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q43072 2.71e-59 196 41 5 260 2 HIS3 Imidazoleglycerol-phosphate dehydratase, chloroplastic Pisum sativum
B8EM89 2.97e-59 192 49 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B9MJR6 2.97e-59 192 47 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A1BF00 4.09e-59 192 47 2 198 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B3QMG8 1.1e-58 191 50 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
O23346 1.11e-58 194 50 3 194 1 HISN5B Imidazoleglycerol-phosphate dehydratase 2, chloroplastic Arabidopsis thaliana
A9KNX4 1.98e-58 190 48 3 192 3 hisB Imidazoleglycerol-phosphate dehydratase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q46CW9 2.55e-58 190 48 1 190 3 hisB Imidazoleglycerol-phosphate dehydratase Methanosarcina barkeri (strain Fusaro / DSM 804)
A4J710 3.36e-58 190 50 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
P58878 4.23e-58 189 48 1 190 3 hisB Imidazoleglycerol-phosphate dehydratase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
B8GJY3 4.7e-58 189 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
A6LT19 5.71e-58 189 49 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A1B384 6.02e-58 189 51 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Paracoccus denitrificans (strain Pd 1222)
B3EKC2 6.68e-58 189 47 2 193 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobium phaeobacteroides (strain BS1)
A3CNT3 8.33e-58 189 49 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Streptococcus sanguinis (strain SK36)
A4XL23 1.34e-57 188 46 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A9W5T6 1.38e-57 188 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methylorubrum extorquens (strain PA1)
B7KPM4 1.56e-57 188 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q5NMD3 1.7e-57 188 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A5V9V7 1.83e-57 188 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q162Q6 2.32e-57 187 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B0T7A1 2.91e-57 187 49 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Caulobacter sp. (strain K31)
Q5LU92 3.35e-57 187 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A3DJF3 4.33e-57 187 48 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A8AY27 5.99e-57 186 49 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q8KEF4 1.02e-56 186 48 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P34047 1.04e-56 188 48 3 194 1 HISN5A Imidazoleglycerol-phosphate dehydratase 1, chloroplastic Arabidopsis thaliana
B1ZAD1 1.08e-56 186 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q0W0J2 1.21e-56 186 49 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
B9KPD2 1.36e-56 186 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
O33564 1.36e-56 186 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A8G2U2 2.22e-56 185 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain MIT 9215)
Q2NHQ1 2.77e-56 185 45 1 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
B1LU98 2.86e-56 185 50 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A4WUS5 3.51e-56 184 51 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A3PI66 5.11e-56 184 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B4SD35 6.45e-56 184 45 2 196 3 hisB Imidazoleglycerol-phosphate dehydratase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
B3QTX2 7.38e-56 184 46 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q3SEU5 7.96e-56 184 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Thiobacillus denitrificans (strain ATCC 25259)
B4RBJ4 8.39e-56 184 49 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Phenylobacterium zucineum (strain HLK1)
Q28NK7 8.86e-56 183 49 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Jannaschia sp. (strain CCS1)
Q3AD51 1.1e-55 183 50 3 192 3 hisB Imidazoleglycerol-phosphate dehydratase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q31CQ1 1.34e-55 183 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain MIT 9312)
A1WW08 1.35e-55 183 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Halorhodospira halophila (strain DSM 244 / SL1)
Q7V314 1.43e-55 183 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q8UJ89 1.53e-55 183 47 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1H4R5 1.72e-55 183 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q2N8I5 1.72e-55 183 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Erythrobacter litoralis (strain HTCC2594)
Q8KY27 1.77e-55 182 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Aminomonas aminovorus
P0CO22 2.02e-55 183 47 4 198 1 HIS3 Imidazoleglycerol-phosphate dehydratase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CO23 2.02e-55 183 47 4 198 3 HIS3 Imidazoleglycerol-phosphate dehydratase Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
Q8DTQ9 2.05e-55 182 48 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P58877 2.08e-55 182 47 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q11CL1 2.17e-55 182 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Chelativorans sp. (strain BNC1)
P34048 2.5e-55 185 48 4 202 2 CAMPLR22A2D_LOCUS4590 Imidazoleglycerol-phosphate dehydratase 1, chloroplastic Triticum aestivum
B8GW12 2.54e-55 182 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A232 2.54e-55 182 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q1MNB6 2.67e-55 182 47 3 198 3 hisB Imidazoleglycerol-phosphate dehydratase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B3EDX3 2.73e-55 182 46 2 198 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
W5BGD1 2.94e-55 184 48 4 202 3 None Imidazoleglycerol-phosphate dehydratase 2, chloroplastic Triticum aestivum
Q31E67 2.96e-55 182 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B2UX23 3.52e-55 182 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium botulinum (strain Alaska E43 / Type E3)
B3PWI5 3.89e-55 182 47 3 198 3 hisB Imidazoleglycerol-phosphate dehydratase Rhizobium etli (strain CIAT 652)
Q2KE56 5.14e-55 182 46 3 198 3 hisB Imidazoleglycerol-phosphate dehydratase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q03K79 5.66e-55 181 49 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
A2BP81 5.86e-55 182 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain AS9601)
A9GZY1 7.61e-55 181 49 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A3CTR8 8.43e-55 181 48 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q1GF01 1.05e-54 181 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Ruegeria sp. (strain TM1040)
A8LQZ6 1.07e-54 181 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q0AEU4 1.25e-54 181 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q21CK7 1.33e-54 181 49 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodopseudomonas palustris (strain BisB18)
A5GID0 1.49e-54 181 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain WH7803)
W5AWH5 1.5e-54 183 48 4 202 3 None Imidazoleglycerol-phosphate dehydratase 3, chloroplastic Triticum aestivum
B2ICL6 1.95e-54 180 47 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B5ZV97 2.13e-54 180 47 4 199 3 hisB Imidazoleglycerol-phosphate dehydratase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A7GDQ3 2.24e-54 180 44 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
C3MBC5 2.73e-54 180 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A0LBT6 2.74e-54 180 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q67KH7 2.92e-54 180 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q50504 3.03e-54 179 45 1 190 3 hisB Imidazoleglycerol-phosphate dehydratase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q97KI1 3.12e-54 179 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q92TB0 3.2e-54 180 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Rhizobium meliloti (strain 1021)
A9BDS9 3.46e-54 180 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain MIT 9211)
A6TKT3 5.13e-54 179 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Alkaliphilus metalliredigens (strain QYMF)
Q5UZF0 5.3e-54 179 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
B0K736 6.8e-54 179 47 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q93DQ9 6.99e-54 179 46 4 206 3 hisB Imidazoleglycerol-phosphate dehydratase Trichodesmium erythraeum (strain IMS101)
B1ILA6 8.06e-54 178 44 4 197 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium botulinum (strain Okra / Type B1)
A5I242 9.67e-54 178 44 4 197 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FU78 9.67e-54 178 44 4 197 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium botulinum (strain ATCC 19397 / Type A)
Q5FTN7 1.01e-53 178 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Gluconobacter oxydans (strain 621H)
A0AG18 1.18e-53 178 47 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A3PB03 1.31e-53 178 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain MIT 9301)
Q18C69 1.33e-53 178 46 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridioides difficile (strain 630)
B0JJ52 1.51e-53 178 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
C4L173 1.55e-53 177 48 3 190 3 hisB Imidazoleglycerol-phosphate dehydratase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
C1FN38 1.59e-53 177 44 4 197 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium botulinum (strain Kyoto / Type A2)
Q2RNA4 1.7e-53 178 45 5 196 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q2KTT4 1.87e-53 177 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Bordetella avium (strain 197N)
A5GWD4 2.19e-53 177 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain RCC307)
A2BUR2 3.98e-53 177 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain MIT 9515)
B3R798 4.61e-53 176 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K689 4.61e-53 176 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q7V4R6 5.03e-53 177 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain MIT 9313)
Q1LIA8 5.65e-53 176 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q46WL4 6.86e-53 176 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A2CCN3 7.25e-53 176 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain MIT 9303)
Q7VSY9 7.4e-53 176 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2Y2 7.4e-53 176 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WDY2 7.4e-53 176 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q46H93 8.69e-53 176 44 3 196 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain NATL2A)
A2C0B5 8.69e-53 176 44 3 196 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain NATL1A)
A6UEK7 8.7e-53 176 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Sinorhizobium medicae (strain WSM419)
B2GBR2 1.03e-52 176 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q2RGV9 1.15e-52 176 46 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q7VDQ5 1.17e-52 176 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A5N7Q8 1.23e-52 175 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E169 1.23e-52 175 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium kluyveri (strain NBRC 12016)
B0K626 1.32e-52 175 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Thermoanaerobacter sp. (strain X514)
O94153 1.7e-52 175 47 4 197 3 HIS3 Imidazoleglycerol-phosphate dehydratase Phaffia rhodozyma
A6WX56 3.03e-52 174 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
C3KVX2 3.29e-52 174 44 4 197 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium botulinum (strain 657 / Type Ba4)
Q3AN36 4.13e-52 174 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain CC9605)
Q2G9M2 5.27e-52 174 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q7UNC2 5.71e-52 174 44 3 197 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A7IHP3 5.75e-52 174 49 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q82WM4 5.94e-52 174 43 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P48054 8.94e-52 174 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B6JAL6 9.32e-52 173 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
P64367 9.87e-52 173 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella suis biovar 1 (strain 1330)
A5VT39 9.87e-52 173 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P64366 9.87e-52 173 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFW9 9.87e-52 173 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M9R5 9.87e-52 173 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57AH7 9.87e-52 173 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella abortus biovar 1 (strain 9-941)
Q2YQZ2 9.87e-52 173 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella abortus (strain 2308)
B2S980 9.87e-52 173 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella abortus (strain S19)
A5CVR1 1.03e-51 173 47 4 192 3 hisB Imidazoleglycerol-phosphate dehydratase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q7NMJ6 1.11e-51 173 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A5E8F1 1.14e-51 173 47 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q7U9M8 1.21e-51 173 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Parasynechococcus marenigrum (strain WH8102)
Q4FNT4 1.25e-51 173 44 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pelagibacter ubique (strain HTCC1062)
C5BMF2 1.5e-51 172 44 3 196 3 hisB Imidazoleglycerol-phosphate dehydratase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q12FD0 1.54e-51 173 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q3B0A6 1.66e-51 172 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain CC9902)
Q8DMI3 2.18e-51 172 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q2S2A1 2.21e-51 172 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Salinibacter ruber (strain DSM 13855 / M31)
A1KAV7 2.71e-51 172 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Azoarcus sp. (strain BH72)
B0TDN0 3.22e-51 172 49 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
B8DA59 3.33e-51 172 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Listeria monocytogenes serotype 4a (strain HCC23)
Q2JRL0 3.33e-51 172 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain JA-3-3Ab)
Q5P792 3.78e-51 171 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B4S729 3.79e-51 172 46 2 181 3 hisB Imidazoleglycerol-phosphate dehydratase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q2J8L0 3.94e-51 171 47 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A9HWC8 4.16e-51 171 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B2UEE9 4.2e-51 171 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Ralstonia pickettii (strain 12J)
Q21NH8 4.33e-51 171 45 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q98CT7 4.41e-51 171 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8ESR9 4.59e-51 171 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q3B4Y6 5.07e-51 171 44 2 198 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B0CJI2 5.33e-51 171 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella suis (strain ATCC 23445 / NCTC 10510)
Q0A5D0 5.55e-51 171 45 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q88UE0 6.01e-51 171 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A1VK39 6.35e-51 171 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Polaromonas naphthalenivorans (strain CJ2)
Q92E85 6.69e-51 171 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q0BPW9 7.92e-51 171 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q8Y9G2 8.84e-51 171 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q722Y4 9.63e-51 171 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Listeria monocytogenes serotype 4b (strain F2365)
C1L0J5 9.63e-51 171 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8XV81 1.06e-50 171 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q603K0 1.23e-50 170 47 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B3WED4 1.68e-50 170 48 3 174 3 hisB Imidazoleglycerol-phosphate dehydratase Lacticaseibacillus casei (strain BL23)
Q13TQ6 1.89e-50 170 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Paraburkholderia xenovorans (strain LB400)
A9WDZ1 2.07e-50 170 43 3 204 3 hisB Imidazoleglycerol-phosphate dehydratase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q47AM0 2.32e-50 169 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Dechloromonas aromatica (strain RCB)
B2SZ63 2.53e-50 169 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A4T9M6 3.45e-50 169 45 6 202 3 hisB Imidazoleglycerol-phosphate dehydratase Mycolicibacterium gilvum (strain PYR-GCK)
Q18DL1 3.6e-50 169 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
A4SV17 3.68e-50 169 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A1U5H8 3.79e-50 169 45 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q5N2A1 4.22e-50 169 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31S12 4.22e-50 169 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q05068 4.6e-50 169 45 3 200 3 hisB Imidazoleglycerol-phosphate dehydratase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A2SE06 5.21e-50 169 45 4 200 3 hisB Imidazoleglycerol-phosphate dehydratase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q0IDH6 5.91e-50 169 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain CC9311)
B8GU29 1.16e-49 168 45 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A8HYU9 1.21e-49 168 50 2 167 3 hisB Imidazoleglycerol-phosphate dehydratase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A0PXP6 1.42e-49 167 44 3 187 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium novyi (strain NT)
B9DQ86 1.56e-49 167 46 3 189 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus carnosus (strain TM300)
A8LGQ5 1.76e-49 167 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Parafrankia sp. (strain EAN1pec)
Q89WM8 1.83e-49 167 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B1XSV0 1.94e-49 167 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q039B2 2.71e-49 167 48 3 174 3 hisB Imidazoleglycerol-phosphate dehydratase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A7I774 2.78e-49 167 44 2 188 3 hisB Imidazoleglycerol-phosphate dehydratase Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
Q01ZU4 3.05e-49 167 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Solibacter usitatus (strain Ellin6076)
B3PGA1 3.49e-49 166 44 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Cellvibrio japonicus (strain Ueda107)
Q0C636 4.15e-49 167 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Hyphomonas neptunium (strain ATCC 15444)
Q2JNK3 5.33e-49 166 45 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain JA-2-3B'a(2-13))
B7HHG2 6.13e-49 166 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain B4264)
A7HSH4 6.5e-49 166 42 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A5WBH9 7.72e-49 166 46 3 198 3 hisB Imidazoleglycerol-phosphate dehydratase Psychrobacter sp. (strain PRwf-1)
Q2YAU7 8.17e-49 166 42 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1R077 8.41e-49 166 45 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
C1DJC9 8.41e-49 166 44 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q3IRM3 9.1e-49 166 46 2 193 3 hisB Imidazoleglycerol-phosphate dehydratase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
C1DAK1 1.22e-48 165 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Laribacter hongkongensis (strain HLHK9)
Q65EG0 1.24e-48 165 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q3JMZ8 1.28e-48 165 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia pseudomallei (strain 1710b)
Q3J6Q4 1.41e-48 165 44 4 193 3 hisB Imidazoleglycerol-phosphate dehydratase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
P28624 1.44e-48 172 46 3 192 3 HIS3 Imidazoleglycerol-phosphate dehydratase Phytophthora nicotianae
B5EQE9 1.54e-48 165 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JA16 1.54e-48 165 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q02YW7 1.8e-48 165 47 6 198 3 hisB Imidazoleglycerol-phosphate dehydratase Lactococcus lactis subsp. cremoris (strain SK11)
B3Q8C2 1.84e-48 165 49 2 167 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodopseudomonas palustris (strain TIE-1)
A6VTA8 1.84e-48 165 45 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Marinomonas sp. (strain MWYL1)
P58879 2.01e-48 165 45 4 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q81G05 2.04e-48 164 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B1W0M1 2.27e-48 164 46 5 196 3 hisB Imidazoleglycerol-phosphate dehydratase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q4KJS8 2.35e-48 164 44 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B2JHY3 2.39e-48 164 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q07UQ5 2.4e-48 164 48 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodopseudomonas palustris (strain BisA53)
C5D7P1 2.44e-48 164 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Geobacillus sp. (strain WCH70)
Q2SMB5 2.48e-48 164 42 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Hahella chejuensis (strain KCTC 2396)
Q0AW39 2.79e-48 164 43 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q2SUA4 2.93e-48 164 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q88 2.93e-48 164 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia pseudomallei (strain K96243)
A3NE97 2.93e-48 164 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia pseudomallei (strain 668)
A3P031 2.93e-48 164 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia pseudomallei (strain 1106a)
A1V8H1 2.93e-48 164 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia mallei (strain SAVP1)
Q62GE1 2.93e-48 164 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia mallei (strain ATCC 23344)
A2S750 2.93e-48 164 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia mallei (strain NCTC 10229)
A3MPU8 2.93e-48 164 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia mallei (strain NCTC 10247)
Q1QRX4 3.32e-48 164 47 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
P18787 3.47e-48 164 42 3 192 3 hisB Imidazoleglycerol-phosphate dehydratase Azospirillum brasilense
P60887 3.85e-48 164 49 2 167 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q13E36 4.57e-48 164 47 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodopseudomonas palustris (strain BisB5)
Q02134 4.8e-48 164 47 6 198 3 hisB Imidazoleglycerol-phosphate dehydratase Lactococcus lactis subsp. lactis (strain IL1403)
A4X9Q4 6.3e-48 164 46 5 201 3 hisB Imidazoleglycerol-phosphate dehydratase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q2FN13 7.46e-48 163 44 2 192 3 hisB Imidazoleglycerol-phosphate dehydratase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
P60885 7.68e-48 163 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A1KV07 7.87e-48 166 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P64371 7.87e-48 166 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P64370 7.87e-48 166 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M186 7.87e-48 166 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Neisseria meningitidis serogroup C (strain 053442)
Q82AA4 8.16e-48 163 46 5 196 3 hisB Imidazoleglycerol-phosphate dehydratase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q5F7D6 8.22e-48 166 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q0VM69 8.58e-48 163 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q5KVC7 8.64e-48 163 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Geobacillus kaustophilus (strain HTA426)
Q2VYI7 9.04e-48 163 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q0BIW8 9.82e-48 163 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRV7 9.82e-48 163 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia ambifaria (strain MC40-6)
B7JFZ2 1.03e-47 162 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain AH820)
A4JAW5 1.26e-47 162 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia vietnamiensis (strain G4 / LMG 22486)
C1EMQ4 1.36e-47 162 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain 03BB102)
A0RBL9 1.36e-47 162 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus thuringiensis (strain Al Hakam)
Q39K89 1.51e-47 162 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q4ZLP8 1.52e-47 162 42 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas syringae pv. syringae (strain B728a)
Q87UG0 1.52e-47 162 42 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48C77 1.52e-47 162 42 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A5USC4 1.61e-47 162 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Roseiflexus sp. (strain RS-1)
Q1B7G6 1.78e-47 162 44 5 200 3 hisB Imidazoleglycerol-phosphate dehydratase Mycobacterium sp. (strain MCS)
A1UHK6 1.78e-47 162 44 5 200 3 hisB Imidazoleglycerol-phosphate dehydratase Mycobacterium sp. (strain KMS)
A3Q129 1.78e-47 162 44 5 200 3 hisB Imidazoleglycerol-phosphate dehydratase Mycobacterium sp. (strain JLS)
A9VLH4 1.79e-47 162 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus mycoides (strain KBAB4)
Q9K6Z3 1.89e-47 162 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q845V1 1.97e-47 162 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia multivorans (strain ATCC 17616 / 249)
B9IUZ7 2.06e-47 162 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain Q1)
B7HKD1 2.06e-47 162 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain AH187)
A0LTS3 2.29e-47 162 42 3 206 3 hisB Imidazoleglycerol-phosphate dehydratase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A1T8W3 2.3e-47 162 43 6 205 3 hisB Imidazoleglycerol-phosphate dehydratase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A7GMU7 2.31e-47 162 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B1JUA1 2.36e-47 162 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia orbicola (strain MC0-3)
B4E637 2.36e-47 162 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B3E4Y5 2.41e-47 162 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q3SWE7 2.46e-47 162 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A7NQZ5 3.02e-47 161 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A2RKS1 3.03e-47 162 47 6 198 3 hisB Imidazoleglycerol-phosphate dehydratase Lactococcus lactis subsp. cremoris (strain MG1363)
Q1BS27 3.06e-47 161 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia orbicola (strain AU 1054)
A0K3V4 3.06e-47 161 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia cenocepacia (strain HI2424)
A4G9I9 3.49e-47 161 42 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Herminiimonas arsenicoxydans
P16247 3.54e-47 161 45 5 196 3 hisB Imidazoleglycerol-phosphate dehydratase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q24QJ2 3.86e-47 161 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Desulfitobacterium hafniense (strain Y51)
Q39YP5 4.21e-47 161 44 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q63DX1 4.41e-47 161 43 4 192 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain ZK / E33L)
B8G451 4.45e-47 161 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q6HLE6 5.17e-47 161 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81T61 5.17e-47 161 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus anthracis
C3L9Q0 5.17e-47 161 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P503 5.17e-47 161 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus anthracis (strain A0248)
A4YJV1 5.37e-47 161 47 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Bradyrhizobium sp. (strain ORS 278)
Q2J344 6.8e-47 160 47 2 167 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodopseudomonas palustris (strain HaA2)
B8I5V2 6.84e-47 160 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A4Y087 7.98e-47 160 42 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas mendocina (strain ymp)
O34683 8.11e-47 160 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus subtilis (strain 168)
B7INA0 1.03e-46 160 42 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain G9842)
A1ATG7 1.22e-46 160 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q5WDH9 1.23e-46 160 44 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Shouchella clausii (strain KSM-K16)
Q3KJI9 1.63e-46 160 42 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas fluorescens (strain Pf0-1)
B0VPC2 1.67e-46 160 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Acinetobacter baumannii (strain SDF)
P61658 1.87e-46 159 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain ATCC 10987 / NRS 248)
A8LX62 2.02e-46 159 45 5 201 3 hisB Imidazoleglycerol-phosphate dehydratase Salinispora arenicola (strain CNS-205)
A1WR21 2.05e-46 160 47 2 168 3 hisB Imidazoleglycerol-phosphate dehydratase Verminephrobacter eiseniae (strain EF01-2)
A4ISR5 2.05e-46 159 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Geobacillus thermodenitrificans (strain NG80-2)
Q12578 2.07e-46 160 44 5 208 3 HIS3 Imidazoleglycerol-phosphate dehydratase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
B0V8S1 2.28e-46 159 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Acinetobacter baumannii (strain AYE)
A0LQG8 2.35e-46 159 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A8ETG3 2.49e-46 159 45 4 189 3 hisB Imidazoleglycerol-phosphate dehydratase Aliarcobacter butzleri (strain RM4018)
Q6F7A8 2.64e-46 159 44 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A6T379 2.81e-46 159 42 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Janthinobacterium sp. (strain Marseille)
Q6ANL7 3.03e-46 159 44 3 197 3 hisB Imidazoleglycerol-phosphate dehydratase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A4VRW2 3.24e-46 159 42 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Stutzerimonas stutzeri (strain A1501)
Q9HU41 3.46e-46 159 43 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EM2 3.46e-46 159 43 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3N7 3.46e-46 159 43 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas aeruginosa (strain LESB58)
A6VDR3 3.46e-46 159 43 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas aeruginosa (strain PA7)
Q7P0F3 3.85e-46 159 43 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1I3G4 4.06e-46 159 43 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas entomophila (strain L48)
A0QX83 4.82e-46 159 43 5 201 1 hisB Imidazoleglycerol-phosphate dehydratase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
H9C4A4 5.77e-46 159 50 3 165 1 HIS3 Imidazoleglycerol-phosphate dehydratase Maudiozyma humilis
A8FHR2 7.59e-46 158 42 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus pumilus (strain SAFR-032)
Q2LVF5 9.15e-46 158 43 4 194 3 hisB Imidazoleglycerol-phosphate dehydratase Syntrophus aciditrophicus (strain SB)
B1JED5 1.04e-45 157 42 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas putida (strain W619)
C3K6U9 1.11e-45 157 42 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas fluorescens (strain SBW25)
Q75B47 1.21e-45 158 48 3 165 3 HIS3 Imidazoleglycerol-phosphate dehydratase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
A7H8C1 1.67e-45 157 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Anaeromyxobacter sp. (strain Fw109-5)
Q92447 1.73e-45 158 49 3 166 3 HIS3 Imidazoleglycerol-phosphate dehydratase Komagataella pastoris
A7Z965 1.97e-45 157 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B5YKN8 2.04e-45 157 42 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q1IKB4 2.73e-45 156 43 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Koribacter versatilis (strain Ellin345)
A1TKZ1 3.2e-45 157 45 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Paracidovorax citrulli (strain AAC00-1)
P40374 3.46e-45 157 41 5 215 1 his5 Imidazoleglycerol-phosphate dehydratase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A4FYS8 4.24e-45 155 42 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Q21U94 5.08e-45 156 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A6UN45 8.49e-45 155 41 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q9UVE1 8.68e-45 156 48 3 165 3 HIS3 Imidazoleglycerol-phosphate dehydratase Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229)
A5G8T2 9.05e-45 155 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Geotalea uraniireducens (strain Rf4)
P06633 1.11e-44 155 46 3 166 1 HIS3 Imidazoleglycerol-phosphate dehydratase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q6CLR6 1.49e-44 155 47 3 165 3 HIS3 Imidazoleglycerol-phosphate dehydratase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q88R45 1.59e-44 154 42 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VX72 1.59e-44 154 42 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A9A756 1.83e-44 154 42 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
O66455 1.99e-44 154 42 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Aquifex aeolicus (strain VF5)
C6BSE1 2.06e-44 154 43 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A1W432 2.28e-44 154 46 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Acidovorax sp. (strain JS42)
B9MDV5 2.28e-44 154 46 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Acidovorax ebreus (strain TPSY)
B9M0L7 2.29e-44 154 43 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A6VJJ9 2.99e-44 154 41 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
Q47QS7 3.81e-44 154 46 6 197 3 hisB Imidazoleglycerol-phosphate dehydratase Thermobifida fusca (strain YX)
Q6XD66 3.9e-44 154 47 3 165 3 HIS3 Imidazoleglycerol-phosphate dehydratase Torulaspora delbrueckii
Q02986 4.25e-44 154 48 3 165 3 HIS3 Imidazoleglycerol-phosphate dehydratase Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651)
P60888 4.54e-44 153 42 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P60884 5.29e-44 153 43 6 204 3 hisB Imidazoleglycerol-phosphate dehydratase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A5FYE1 5.91e-44 153 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Acidiphilium cryptum (strain JF-5)
C0QUG8 9.6e-44 152 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Persephonella marina (strain DSM 14350 / EX-H1)
Q96UK2 9.95e-44 153 45 4 184 2 HIS3 Imidazoleglycerol-phosphate dehydratase Zygosaccharomyces bailii
B5EDR7 1.15e-43 152 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q6A8L3 1.31e-43 152 43 6 202 3 hisB Imidazoleglycerol-phosphate dehydratase Cutibacterium acnes (strain DSM 16379 / KPA171202)
P56090 1.34e-43 153 45 3 166 3 HIS3 Imidazoleglycerol-phosphate dehydratase Candida albicans
A5CZ77 1.39e-43 152 42 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
O94126 1.47e-43 153 39 6 226 3 HIS3 Imidazoleglycerol-phosphate dehydratase Cyberlindnera jadinii
B1I559 1.51e-43 152 43 3 192 3 hisB Imidazoleglycerol-phosphate dehydratase Desulforudis audaxviator (strain MP104C)
C6E7F7 1.78e-43 152 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Geobacter sp. (strain M21)
B2UL23 2e-43 152 42 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
A4YI33 2.05e-43 151 45 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
B0KI41 2.39e-43 151 42 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas putida (strain GB-1)
C1A0M3 3.99e-43 151 42 7 204 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
A0RQ64 4.86e-43 150 43 4 186 3 hisB Imidazoleglycerol-phosphate dehydratase Campylobacter fetus subsp. fetus (strain 82-40)
A6Q330 9.61e-43 150 42 4 189 3 hisB Imidazoleglycerol-phosphate dehydratase Nitratiruptor sp. (strain SB155-2)
Q9RX91 1.58e-42 149 42 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A9WQ57 1.89e-42 149 41 5 199 3 hisB Imidazoleglycerol-phosphate dehydratase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
A0JUZ5 1.97e-42 149 40 5 199 3 hisB Imidazoleglycerol-phosphate dehydratase Arthrobacter sp. (strain FB24)
Q2INV5 2.04e-42 149 42 4 189 3 hisB Imidazoleglycerol-phosphate dehydratase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q58109 2.17e-42 149 44 3 189 3 hisB Imidazoleglycerol-phosphate dehydratase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q03VX7 2.43e-42 149 42 3 190 3 hisB Imidazoleglycerol-phosphate dehydratase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q9HN13 3.48e-42 148 42 2 194 3 hisB Imidazoleglycerol-phosphate dehydratase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R7J1 3.48e-42 148 42 2 194 3 hisB Imidazoleglycerol-phosphate dehydratase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
O42621 4.23e-42 149 47 5 169 3 PTH3 Imidazoleglycerol-phosphate dehydratase Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
A1SL60 5.46e-42 148 41 4 200 3 hisB Imidazoleglycerol-phosphate dehydratase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q3A134 6.47e-42 147 41 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
C1ATZ4 8.41e-42 147 41 6 205 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodococcus opacus (strain B4)
A1R559 8.76e-42 148 40 5 199 3 hisB Imidazoleglycerol-phosphate dehydratase Paenarthrobacter aurescens (strain TC1)
Q0SHY0 9.65e-42 147 41 6 205 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodococcus jostii (strain RHA1)
P64374 1.59e-41 146 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain MW2)
A8Z5H6 1.59e-41 146 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G5Z9 1.59e-41 146 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain MSSA476)
P64373 1.59e-41 146 41 4 187 1 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain N315)
P64372 1.59e-41 146 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QKG4 1.59e-41 146 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain Newman)
Q5HCM1 1.59e-41 146 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain COL)
A5IWA3 1.59e-41 146 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain JH9)
Q2FUU0 1.59e-41 146 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FDI5 1.59e-41 146 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain USA300)
A6U561 1.59e-41 146 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain JH1)
A7X766 1.59e-41 146 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain Mu3 / ATCC 700698)
B8HGA0 1.92e-41 147 40 5 199 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A7GXG2 2e-41 146 43 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Campylobacter curvus (strain 525.92)
Q9C1D4 2.11e-41 147 45 3 166 3 HIS3 Imidazoleglycerol-phosphate dehydratase Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
P60886 2.12e-41 147 42 5 192 3 hisB Imidazoleglycerol-phosphate dehydratase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QHI0 2.12e-41 147 42 5 192 3 hisB Imidazoleglycerol-phosphate dehydratase Mycobacterium avium (strain 104)
B8JDL0 2.14e-41 147 43 4 185 3 hisB Imidazoleglycerol-phosphate dehydratase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q1IZQ5 2.17e-41 147 41 3 197 3 hisB Imidazoleglycerol-phosphate dehydratase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q2YZ91 2.34e-41 146 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain bovine RF122 / ET3-1)
B4UDJ7 3.24e-41 146 43 4 185 3 hisB Imidazoleglycerol-phosphate dehydratase Anaeromyxobacter sp. (strain K)
A7I064 4.7e-41 145 43 4 186 3 hisB Imidazoleglycerol-phosphate dehydratase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A8ZUC7 6.24e-41 145 39 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
A8M909 7.46e-41 145 39 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167)
A5CSK8 9.56e-41 145 42 5 197 3 hisB Imidazoleglycerol-phosphate dehydratase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q7VGJ6 1.14e-40 145 42 5 193 3 hisB Imidazoleglycerol-phosphate dehydratase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A6UTB1 1.15e-40 144 41 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
A7ZEG5 1.39e-40 144 41 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Campylobacter concisus (strain 13826)
B0RHB5 1.75e-40 144 42 5 197 3 hisB Imidazoleglycerol-phosphate dehydratase Clavibacter sepedonicus
C3NGY0 1.98e-40 144 41 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
C3MQI6 1.98e-40 144 41 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
Q6AE13 2.25e-40 144 40 5 198 3 hisB Imidazoleglycerol-phosphate dehydratase Leifsonia xyli subsp. xyli (strain CTCB07)
Q5HKN9 2.31e-40 144 40 5 190 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4A046 2.43e-40 143 39 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8CQ94 2.7e-40 143 40 5 190 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
C3N6A7 2.81e-40 143 41 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Sulfolobus islandicus (strain M.16.27)
C3MW64 3e-40 143 41 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C4KHS1 3e-40 143 41 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
C3NER4 3.13e-40 143 41 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
Q6GDC8 3.92e-40 143 40 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain MRSA252)
B8DSW4 3.96e-40 143 40 6 199 3 hisB Imidazoleglycerol-phosphate dehydratase Bifidobacterium animalis subsp. lactis (strain AD011)
C1D1S1 4.37e-40 143 40 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
B1VH93 4.63e-40 143 44 5 203 3 hisB Imidazoleglycerol-phosphate dehydratase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
C4XSN6 5.75e-40 142 40 3 192 3 hisB Imidazoleglycerol-phosphate dehydratase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q5SL64 6.36e-40 142 42 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P61661 6.78e-40 142 42 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01100
Feature type CDS
Gene hisB
Product bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB
Location 232248 - 233315 (strand: -1)
Length 1068 (nucleotides) / 355 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1197
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00475 Imidazoleglycerol-phosphate dehydratase
PF13242 HAD-hyrolase-like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0131 Amino acid transport and metabolism (E) E Imidazoleglycerol phosphate dehydratase HisB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01089 imidazoleglycerol-phosphate dehydratase / histidinol-phosphatase [EC:4.2.1.19 3.1.3.15] Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids		 Histidine biosynthesis, PRPP => histidine

Protein Sequence

MTQKVLFIDRDGTLISEPPVDFQVDRLDKLVFEENVIPALLKLKAAGYRFVMVTNQDGLGTESFPQADFDAPHQLMMQVFTSQGITFDEVLICPHKPADSCNCRKPKITLVKNYLLPGVIDPQNSYVIGDRETDIQLAENMGITGLRYGQPGMDWNSIAEQLTRRDRYSRIERKTKETDIVTEVWLDREGGSTIRTGVGFFDHMLDQIATHGGFQLNIQVSGDLVIDDHHSVEDTGLALGEALKLALGDKRGITRFGFTLPMDECLARCALDISGRPHLEYKADFKFQRVGDLSTEMIEHFFSSLSYTMGCTLHLKTKGKNDHHRAESLFKVFGRTLRQAIRVEGDVLPSSKGVL

Flanking regions ( +/- flanking 50bp)

TGCCGCTATCGCCACCCTTAAAATGCCTTAATCTGAGGACGACGGATATCATGACACAGAAAGTCTTATTTATTGACCGCGACGGCACTCTGATCAGCGAACCACCGGTGGATTTCCAGGTAGACCGGCTTGATAAACTGGTTTTTGAGGAAAATGTTATCCCCGCGCTGCTGAAACTGAAAGCCGCCGGATACCGCTTTGTGATGGTGACAAATCAGGACGGGCTGGGCACAGAAAGCTTCCCGCAGGCTGATTTTGACGCACCGCACCAGCTGATGATGCAGGTTTTTACCTCACAGGGTATTACCTTTGATGAAGTACTGATTTGTCCGCACAAACCGGCGGATAGCTGCAACTGCCGCAAACCTAAAATCACCCTGGTGAAAAACTATCTGCTGCCGGGCGTGATAGATCCACAGAACAGCTATGTCATCGGCGATCGCGAAACTGATATTCAGCTCGCGGAAAATATGGGAATAACCGGTCTGCGTTATGGTCAGCCGGGCATGGACTGGAACAGTATCGCAGAGCAGCTTACGCGCCGTGACCGCTACAGCCGCATAGAGCGTAAAACAAAAGAGACGGATATTGTGACCGAAGTCTGGCTTGACCGCGAAGGCGGCAGCACTATCCGCACCGGTGTGGGTTTCTTTGATCACATGCTGGATCAGATTGCGACCCACGGCGGATTCCAGCTCAATATTCAGGTCAGCGGCGACCTGGTGATTGACGATCATCACTCAGTGGAAGATACCGGGCTGGCACTCGGCGAAGCGCTGAAACTGGCACTTGGTGATAAGCGCGGGATCACCCGTTTCGGATTCACCCTGCCAATGGATGAATGTCTCGCCCGCTGTGCGTTGGATATCTCCGGGCGTCCTCACCTTGAATACAAAGCGGATTTTAAATTTCAGCGTGTCGGTGACCTGAGTACAGAGATGATAGAGCACTTTTTCAGCTCCCTCTCCTACACCATGGGCTGTACATTGCACCTGAAAACCAAAGGGAAAAACGATCACCACCGCGCCGAAAGCCTGTTTAAAGTCTTCGGACGAACACTGCGCCAGGCTATCCGCGTGGAAGGGGATGTCCTGCCCAGCTCGAAAGGGGTGTTGTGATGAACATTGTCATTACCGACACCGGCTGCGCCAATATCGCGTCCGTCCGC