Homologs in group_1255

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06915 FBDBKF_06915 100.0 Morganella morganii S1 hisB bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB
EHELCC_04055 EHELCC_04055 100.0 Morganella morganii S2 hisB bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB
NLDBIP_04055 NLDBIP_04055 100.0 Morganella morganii S4 hisB bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB
LHKJJB_09885 LHKJJB_09885 100.0 Morganella morganii S3 hisB bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB
F4V73_RS01100 F4V73_RS01100 93.2 Morganella psychrotolerans hisB bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB
PMI_RS03260 PMI_RS03260 79.4 Proteus mirabilis HI4320 hisB bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB

Distribution of the homologs in the orthogroup group_1255

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1255

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P06987 0.0 604 81 0 355 1 hisB Histidine biosynthesis bifunctional protein HisB Escherichia coli (strain K12)
Q9S5G5 0.0 602 80 0 355 1 hisB Histidine biosynthesis bifunctional protein HisB Escherichia coli O157:H7
P10368 0.0 602 80 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PDP5 0.0 602 80 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q83R05 0.0 600 80 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Shigella flexneri
Q8Z5J8 0.0 599 80 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Salmonella typhi
Q8FG50 0.0 599 80 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7N6I2 0.0 594 79 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8ZFX7 0.0 593 78 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Yersinia pestis
Q66C51 0.0 591 77 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Yersinia pseudotuberculosis serotype I (strain IP32953)
A6TBC5 0.0 587 78 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q6D409 0.0 581 77 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NTX3 0.0 568 75 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Sodalis glossinidius (strain morsitans)
Q7MLS4 0.0 513 68 0 353 3 hisB Histidine biosynthesis bifunctional protein HisB Vibrio vulnificus (strain YJ016)
Q8D8Q2 0.0 511 68 0 353 3 hisB Histidine biosynthesis bifunctional protein HisB Vibrio vulnificus (strain CMCP6)
Q1LT69 0.0 509 67 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Baumannia cicadellinicola subsp. Homalodisca coagulata
Q9KSX1 0.0 509 69 0 353 3 hisB Histidine biosynthesis bifunctional protein HisB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87QK9 0.0 508 67 0 353 3 hisB Histidine biosynthesis bifunctional protein HisB Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P62455 0.0 508 67 1 358 3 hisB Histidine biosynthesis bifunctional protein HisB Photobacterium profundum (strain SS9)
P57920 1.34e-179 504 67 2 361 3 hisB Histidine biosynthesis bifunctional protein HisB Pasteurella multocida (strain Pm70)
B0BU51 6.17e-179 503 66 2 362 3 hisB Histidine biosynthesis bifunctional protein HisB Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZG9 1.53e-178 502 66 2 362 3 hisB Histidine biosynthesis bifunctional protein HisB Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3W1 3.43e-178 501 66 2 364 3 hisB Histidine biosynthesis bifunctional protein HisB Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VM11 1.13e-176 497 64 2 362 3 hisB Histidine biosynthesis bifunctional protein HisB Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P44327 1.09e-175 495 65 2 362 3 hisB Histidine biosynthesis bifunctional protein HisB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UGY3 4.89e-175 493 64 2 362 3 hisB Histidine biosynthesis bifunctional protein HisB Haemophilus influenzae (strain PittGG)
A5UA18 4.89e-175 493 64 2 362 3 hisB Histidine biosynthesis bifunctional protein HisB Haemophilus influenzae (strain PittEE)
Q4QN72 1.03e-174 492 64 2 362 3 hisB Histidine biosynthesis bifunctional protein HisB Haemophilus influenzae (strain 86-028NP)
Q65RB3 7.28e-174 490 64 3 366 3 hisB Histidine biosynthesis bifunctional protein HisB Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q15RU7 1.52e-171 484 65 0 353 3 hisB Histidine biosynthesis bifunctional protein HisB Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q8EFB3 4.2e-162 460 60 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q47XB6 3.16e-161 458 60 1 356 3 hisB Histidine biosynthesis bifunctional protein HisB Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q7VQW8 6.36e-157 447 57 1 356 3 hisB Histidine biosynthesis bifunctional protein HisB Blochmanniella floridana
P59454 2.35e-155 443 57 2 357 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B8D708 2.87e-152 435 57 1 355 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57203 2.87e-152 435 57 1 355 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8Q4 2.87e-152 435 57 1 355 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q9PM76 1.64e-151 433 57 2 355 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A1W1K1 1.92e-151 433 57 2 355 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FNR1 2.33e-151 433 57 2 355 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q9ZHE4 6.93e-151 432 54 0 355 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A7H5U9 1.34e-150 431 57 2 355 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q5HSJ2 2.85e-150 430 56 2 355 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni (strain RM1221)
B4STN9 1.6e-136 395 57 3 355 3 hisB Histidine biosynthesis bifunctional protein HisB Stenotrophomonas maltophilia (strain R551-3)
B2FPM1 6.39e-136 394 56 3 355 3 hisB Histidine biosynthesis bifunctional protein HisB Stenotrophomonas maltophilia (strain K279a)
B0RSL6 4.99e-133 387 54 4 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas campestris pv. campestris (strain B100)
Q5ZW89 8e-133 385 52 2 353 3 hisB Histidine biosynthesis bifunctional protein HisB Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5WX93 1.15e-132 385 51 2 353 3 hisB Histidine biosynthesis bifunctional protein HisB Legionella pneumophila (strain Lens)
P58882 1.33e-132 386 54 4 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UU42 1.33e-132 386 54 4 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas campestris pv. campestris (strain 8004)
Q5X5X1 1.43e-131 382 51 2 353 3 hisB Histidine biosynthesis bifunctional protein HisB Legionella pneumophila (strain Paris)
P58881 3.54e-129 377 52 4 374 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas axonopodis pv. citri (strain 306)
Q5H0K9 3.95e-129 377 52 4 374 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SKN6 3.95e-129 377 52 4 374 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P3K1 3.95e-129 377 52 4 374 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BUF5 4.92e-129 377 52 4 374 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q87C31 1.94e-127 373 52 3 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5X9 1.94e-127 373 52 3 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xylella fastidiosa (strain M23)
B0U3B1 8.73e-127 371 52 3 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xylella fastidiosa (strain M12)
Q9PBC7 5.11e-126 369 52 3 373 3 hisB Histidine biosynthesis bifunctional protein HisB Xylella fastidiosa (strain 9a5c)
D2QPE6 1.31e-116 345 47 4 382 1 hisB Histidine biosynthesis bifunctional protein HisB Spirosoma linguale (strain ATCC 33905 / DSM 74 / LMG 10896 / Claus 1)
Q64RE9 1.95e-116 345 46 3 374 3 hisB Histidine biosynthesis bifunctional protein HisB Bacteroides fragilis (strain YCH46)
Q5LB00 1.95e-116 345 46 3 374 3 hisB Histidine biosynthesis bifunctional protein HisB Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q8ABA7 2.72e-115 342 46 3 374 1 hisB Histidine biosynthesis bifunctional protein HisB Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q1GNC0 2.25e-65 208 53 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A4SF66 1.4e-63 204 47 2 200 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q12WC5 3.75e-63 202 50 1 190 3 hisB Imidazoleglycerol-phosphate dehydratase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q3AQD7 7.65e-62 199 48 2 196 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobium chlorochromatii (strain CaD3)
Q8PWS1 2.12e-61 198 47 1 190 3 hisB Imidazoleglycerol-phosphate dehydratase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
A6LT19 2.04e-60 195 50 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A5UMI3 3.36e-60 195 47 1 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
B8GJY3 1.14e-59 193 51 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
A4J710 1.38e-59 193 51 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B1H0E9 1.85e-59 193 48 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Endomicrobium trichonymphae
Q43072 2.07e-59 196 42 5 260 2 HIS3 Imidazoleglycerol-phosphate dehydratase, chloroplastic Pisum sativum
B8EM89 3.16e-59 192 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
O23346 3.44e-59 195 51 3 194 1 HISN5B Imidazoleglycerol-phosphate dehydratase 2, chloroplastic Arabidopsis thaliana
B9MJR6 4.38e-59 192 47 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B3QMG8 1.18e-58 191 50 2 188 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A1BF00 1.87e-58 191 46 2 198 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A9W5T6 1.98e-58 190 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methylorubrum extorquens (strain PA1)
B7KPM4 2.65e-58 190 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q46CW9 2.69e-58 190 47 1 190 3 hisB Imidazoleglycerol-phosphate dehydratase Methanosarcina barkeri (strain Fusaro / DSM 804)
A4XL23 3.75e-58 189 47 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A3DJF3 4.13e-58 189 49 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A9KNX4 4.6e-58 189 47 3 192 3 hisB Imidazoleglycerol-phosphate dehydratase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q5NMD3 4.7e-58 189 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B0T7A1 5.64e-58 189 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Caulobacter sp. (strain K31)
P58878 8.44e-58 189 47 1 190 3 hisB Imidazoleglycerol-phosphate dehydratase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
A3CNT3 1.08e-57 188 48 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Streptococcus sanguinis (strain SK36)
A1B384 1.11e-57 188 51 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Paracoccus denitrificans (strain Pd 1222)
Q2NHQ1 2e-57 187 46 1 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
B1ZAD1 2.1e-57 187 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B3EKC2 2.31e-57 187 47 2 193 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobium phaeobacteroides (strain BS1)
P34047 2.78e-57 190 49 3 194 1 HISN5A Imidazoleglycerol-phosphate dehydratase 1, chloroplastic Arabidopsis thaliana
Q0W0J2 2.82e-57 187 50 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
A1WW08 3.84e-57 187 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Halorhodospira halophila (strain DSM 244 / SL1)
Q8KEF4 7.93e-57 186 48 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A8AY27 8.93e-57 186 48 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q3AD51 8.95e-57 186 51 3 192 3 hisB Imidazoleglycerol-phosphate dehydratase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A5V9V7 1.16e-56 186 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
P58877 1.17e-56 186 48 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q5LU92 1.18e-56 186 49 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q2N8I5 1.63e-56 186 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Erythrobacter litoralis (strain HTCC2594)
B4RBJ4 2.09e-56 185 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Phenylobacterium zucineum (strain HLK1)
Q3SEU5 2.51e-56 185 49 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Thiobacillus denitrificans (strain ATCC 25259)
Q1H4R5 3.01e-56 185 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B2UX23 3.36e-56 184 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium botulinum (strain Alaska E43 / Type E3)
Q162Q6 3.4e-56 184 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A6TKT3 4.45e-56 184 47 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Alkaliphilus metalliredigens (strain QYMF)
B8GW12 4.49e-56 184 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A232 4.49e-56 184 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8KY27 4.64e-56 184 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Aminomonas aminovorus
Q11CL1 5.54e-56 184 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Chelativorans sp. (strain BNC1)
A4WUS5 5.7e-56 184 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A9GZY1 6.39e-56 184 50 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q5UZF0 7.46e-56 184 49 2 193 3 hisB Imidazoleglycerol-phosphate dehydratase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
B3QTX2 8.31e-56 184 46 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A7GDQ3 1.15e-55 183 45 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q1MNB6 1.15e-55 183 47 3 198 3 hisB Imidazoleglycerol-phosphate dehydratase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B4SD35 1.23e-55 183 45 2 196 3 hisB Imidazoleglycerol-phosphate dehydratase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q18C69 1.31e-55 183 47 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridioides difficile (strain 630)
P0CO22 1.35e-55 183 47 4 198 1 HIS3 Imidazoleglycerol-phosphate dehydratase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CO23 1.35e-55 183 47 4 198 3 HIS3 Imidazoleglycerol-phosphate dehydratase Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
B9KPD2 1.69e-55 183 49 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
O33564 1.69e-55 183 49 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q8DTQ9 1.87e-55 182 48 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B3PWI5 1.87e-55 183 47 3 198 3 hisB Imidazoleglycerol-phosphate dehydratase Rhizobium etli (strain CIAT 652)
Q8UJ89 1.88e-55 183 47 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Agrobacterium fabrum (strain C58 / ATCC 33970)
C4L173 2.39e-55 182 50 3 190 3 hisB Imidazoleglycerol-phosphate dehydratase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A8G2U2 2.5e-55 182 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain MIT 9215)
Q2KE56 2.53e-55 182 47 3 198 3 hisB Imidazoleglycerol-phosphate dehydratase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3R798 2.87e-55 182 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K689 2.87e-55 182 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P34048 2.94e-55 184 48 4 202 2 CAMPLR22A2D_LOCUS4590 Imidazoleglycerol-phosphate dehydratase 1, chloroplastic Triticum aestivum
Q1LIA8 2.99e-55 182 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
W5BGD1 3.07e-55 184 48 4 202 3 None Imidazoleglycerol-phosphate dehydratase 2, chloroplastic Triticum aestivum
B0K736 3.34e-55 182 48 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q46WL4 3.44e-55 182 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q67KH7 3.9e-55 182 51 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q97KI1 4.31e-55 182 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q5FTN7 5.06e-55 182 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Gluconobacter oxydans (strain 621H)
A3CTR8 5.6e-55 181 47 2 192 3 hisB Imidazoleglycerol-phosphate dehydratase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
A3PI66 6.22e-55 181 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B1LU98 6.43e-55 181 48 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A8LQZ6 6.5e-55 181 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A5I242 7e-55 181 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FU78 7e-55 181 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium botulinum (strain ATCC 19397 / Type A)
Q31E67 7.16e-55 181 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B3EDX3 7.43e-55 181 46 2 198 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q03K79 7.56e-55 181 49 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
B5ZV97 8.71e-55 181 48 4 199 3 hisB Imidazoleglycerol-phosphate dehydratase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B2ICL6 9.89e-55 181 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
C1FN38 1.02e-54 181 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium botulinum (strain Kyoto / Type A2)
B1ILA6 1.08e-54 181 45 4 197 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium botulinum (strain Okra / Type B1)
C3MBC5 1.08e-54 181 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q31CQ1 1.15e-54 181 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain MIT 9312)
Q1GF01 1.17e-54 181 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Ruegeria sp. (strain TM1040)
Q0AEU4 1.17e-54 181 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q92TB0 1.28e-54 181 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Rhizobium meliloti (strain 1021)
Q7V314 1.36e-54 181 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q50504 1.46e-54 180 45 1 190 3 hisB Imidazoleglycerol-phosphate dehydratase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
W5AWH5 1.48e-54 183 48 4 202 3 None Imidazoleglycerol-phosphate dehydratase 3, chloroplastic Triticum aestivum
A0LBT6 1.52e-54 180 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q21CK7 2.71e-54 180 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodopseudomonas palustris (strain BisB18)
B0JJ52 3.01e-54 180 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
A2BP81 4.34e-54 179 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain AS9601)
Q28NK7 4.71e-54 179 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Jannaschia sp. (strain CCS1)
Q7V4R6 4.93e-54 179 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain MIT 9313)
A2CCN3 5.26e-54 179 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain MIT 9303)
A0AG18 5.54e-54 179 48 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A5GID0 7.18e-54 179 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain WH7803)
Q2RGV9 7.55e-54 179 47 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A9BDS9 7.59e-54 179 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain MIT 9211)
A5N7Q8 1e-53 178 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E169 1e-53 178 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium kluyveri (strain NBRC 12016)
A5GWD4 1.09e-53 178 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain RCC307)
Q93DQ9 1.39e-53 178 46 3 205 3 hisB Imidazoleglycerol-phosphate dehydratase Trichodesmium erythraeum (strain IMS101)
B0K626 1.51e-53 177 47 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Thermoanaerobacter sp. (strain X514)
A3PB03 1.87e-53 177 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain MIT 9301)
O94153 2.28e-53 177 48 4 197 3 HIS3 Imidazoleglycerol-phosphate dehydratase Phaffia rhodozyma
C3KVX2 2.84e-53 177 45 4 197 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium botulinum (strain 657 / Type Ba4)
Q82WM4 2.86e-53 177 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q2RNA4 3.11e-53 177 46 5 196 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A6UEK7 3.68e-53 177 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Sinorhizobium medicae (strain WSM419)
B2GBR2 4.33e-53 176 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q46H93 4.41e-53 177 44 3 196 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain NATL2A)
A2C0B5 4.41e-53 177 44 3 196 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain NATL1A)
Q2KTT4 6.93e-53 176 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Bordetella avium (strain 197N)
B2UEE9 7e-53 176 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Ralstonia pickettii (strain 12J)
A2BUR2 7.74e-53 176 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain MIT 9515)
Q7VDQ5 1.14e-52 176 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q7NMJ6 1.76e-52 175 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q8XV81 1.86e-52 175 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q12FD0 2.07e-52 175 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q3AN36 2.22e-52 175 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain CC9605)
B0TDN0 2.41e-52 174 50 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q3B0A6 2.58e-52 175 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain CC9902)
Q7VSY9 2.75e-52 174 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2Y2 2.75e-52 174 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WDY2 2.75e-52 174 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q603K0 2.8e-52 174 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8ESR9 2.84e-52 174 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A1VK39 3.01e-52 175 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Polaromonas naphthalenivorans (strain CJ2)
Q13TQ6 3.55e-52 174 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Paraburkholderia xenovorans (strain LB400)
C5BMF2 5e-52 174 45 3 196 3 hisB Imidazoleglycerol-phosphate dehydratase Teredinibacter turnerae (strain ATCC 39867 / T7901)
A4SV17 5.07e-52 174 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B2SZ63 5.76e-52 174 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q4FNT4 6.84e-52 174 44 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pelagibacter ubique (strain HTCC1062)
Q7U9M8 7e-52 174 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Parasynechococcus marenigrum (strain WH8102)
B6JAL6 7.68e-52 173 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q8DMI3 8.11e-52 174 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q2S2A1 9.76e-52 173 47 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Salinibacter ruber (strain DSM 13855 / M31)
A7IHP3 1.05e-51 173 49 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q2JRL0 1.15e-51 173 47 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain JA-3-3Ab)
A6WX56 1.33e-51 173 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A1KAV7 1.44e-51 172 47 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Azoarcus sp. (strain BH72)
B8DA59 1.71e-51 172 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Listeria monocytogenes serotype 4a (strain HCC23)
P48054 1.76e-51 173 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7UNC2 2.03e-51 172 44 3 197 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q0BPW9 2.3e-51 172 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q5P792 2.33e-51 172 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A5CVR1 2.39e-51 172 47 4 192 3 hisB Imidazoleglycerol-phosphate dehydratase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q2G9M2 2.48e-51 172 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q2J8L0 2.49e-51 172 47 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q92E85 2.49e-51 172 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B9DQ86 3.12e-51 172 47 3 189 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus carnosus (strain TM300)
A9HWC8 3.22e-51 172 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q722Y4 3.44e-51 172 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Listeria monocytogenes serotype 4b (strain F2365)
C1L0J5 3.44e-51 172 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q5N2A1 3.73e-51 172 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31S12 3.73e-51 172 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B1XSV0 3.74e-51 172 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q8Y9G2 3.91e-51 171 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B3WED4 3.99e-51 171 49 3 174 3 hisB Imidazoleglycerol-phosphate dehydratase Lacticaseibacillus casei (strain BL23)
B7HHG2 4.17e-51 171 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain B4264)
P64367 4.73e-51 171 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella suis biovar 1 (strain 1330)
A5VT39 4.73e-51 171 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P64366 4.73e-51 171 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFW9 4.73e-51 171 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M9R5 4.73e-51 171 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57AH7 4.73e-51 171 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella abortus biovar 1 (strain 9-941)
Q2YQZ2 4.73e-51 171 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella abortus (strain 2308)
B2S980 4.73e-51 171 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella abortus (strain S19)
B4S729 4.75e-51 171 46 2 181 3 hisB Imidazoleglycerol-phosphate dehydratase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A5E8F1 6.38e-51 171 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A1U5H8 7.02e-51 171 46 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q0A5D0 8.08e-51 171 45 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q98CT7 9.66e-51 171 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q05068 1.28e-50 171 46 3 200 3 hisB Imidazoleglycerol-phosphate dehydratase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q81G05 1.36e-50 170 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q88UE0 1.42e-50 170 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A0PXP6 1.56e-50 170 45 3 187 3 hisB Imidazoleglycerol-phosphate dehydratase Clostridium novyi (strain NT)
Q2YAU7 1.74e-50 170 43 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q3B4Y6 1.86e-50 170 43 2 198 3 hisB Imidazoleglycerol-phosphate dehydratase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A2SE06 1.94e-50 170 46 4 200 3 hisB Imidazoleglycerol-phosphate dehydratase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q47AM0 2.13e-50 169 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Dechloromonas aromatica (strain RCB)
B8GU29 2.19e-50 170 46 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
B0CJI2 2.39e-50 170 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Brucella suis (strain ATCC 23445 / NCTC 10510)
A9WDZ1 3.15e-50 169 43 3 204 3 hisB Imidazoleglycerol-phosphate dehydratase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q3JMZ8 3.56e-50 169 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia pseudomallei (strain 1710b)
A7HSH4 3.75e-50 169 43 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B2JHY3 4.37e-50 169 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q21NH8 4.45e-50 169 45 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q2SUA4 4.46e-50 169 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A8LGQ5 4.56e-50 169 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Parafrankia sp. (strain EAN1pec)
Q0IDH6 4.56e-50 169 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain CC9311)
A4T9M6 4.66e-50 169 44 4 200 3 hisB Imidazoleglycerol-phosphate dehydratase Mycolicibacterium gilvum (strain PYR-GCK)
Q2JNK3 4.72e-50 169 47 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q039B2 6.8e-50 168 48 3 174 3 hisB Imidazoleglycerol-phosphate dehydratase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q63Q88 7.39e-50 168 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia pseudomallei (strain K96243)
A3NE97 7.39e-50 168 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia pseudomallei (strain 668)
A3P031 7.39e-50 168 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia pseudomallei (strain 1106a)
A1V8H1 7.39e-50 168 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia mallei (strain SAVP1)
Q62GE1 7.39e-50 168 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia mallei (strain ATCC 23344)
A2S750 7.39e-50 168 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia mallei (strain NCTC 10229)
A3MPU8 7.39e-50 168 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia mallei (strain NCTC 10247)
Q18DL1 8.67e-50 169 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
C1DJC9 9.64e-50 168 45 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q1R077 1.07e-49 168 46 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A9VLH4 1.23e-49 167 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus mycoides (strain KBAB4)
Q3IRM3 1.31e-49 167 47 2 193 3 hisB Imidazoleglycerol-phosphate dehydratase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
B9IUZ7 1.38e-49 167 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain Q1)
B7HKD1 1.38e-49 167 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain AH187)
Q89WM8 1.39e-49 167 48 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B5EQE9 1.71e-49 167 47 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JA16 1.71e-49 167 47 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A8HYU9 1.89e-49 167 50 2 167 3 hisB Imidazoleglycerol-phosphate dehydratase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B7JFZ2 2.19e-49 167 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain AH820)
Q02YW7 2.25e-49 167 47 6 198 3 hisB Imidazoleglycerol-phosphate dehydratase Lactococcus lactis subsp. cremoris (strain SK11)
A7GMU7 2.26e-49 167 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A7I774 2.37e-49 167 44 2 188 3 hisB Imidazoleglycerol-phosphate dehydratase Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
A6VTA8 2.48e-49 167 46 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Marinomonas sp. (strain MWYL1)
Q0BIW8 2.57e-49 167 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRV7 2.57e-49 167 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia ambifaria (strain MC40-6)
C1EMQ4 2.8e-49 167 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain 03BB102)
A0RBL9 2.8e-49 167 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus thuringiensis (strain Al Hakam)
A4JAW5 2.98e-49 167 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q39K89 3.08e-49 167 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q4KJS8 3.17e-49 167 45 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B1W0M1 3.41e-49 167 47 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
A5WBH9 4.02e-49 167 46 3 198 3 hisB Imidazoleglycerol-phosphate dehydratase Psychrobacter sp. (strain PRwf-1)
B3PGA1 4.23e-49 166 44 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Cellvibrio japonicus (strain Ueda107)
Q845V1 4.73e-49 166 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia multivorans (strain ATCC 17616 / 249)
Q2SMB5 4.92e-49 166 43 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Hahella chejuensis (strain KCTC 2396)
Q65EG0 5e-49 166 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q02134 5e-49 166 47 6 198 3 hisB Imidazoleglycerol-phosphate dehydratase Lactococcus lactis subsp. lactis (strain IL1403)
B1JUA1 5.55e-49 166 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia orbicola (strain MC0-3)
B4E637 5.55e-49 166 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B7INA0 5.87e-49 166 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain G9842)
Q3J6Q4 6.79e-49 166 45 4 193 3 hisB Imidazoleglycerol-phosphate dehydratase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q0C636 6.79e-49 166 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Hyphomonas neptunium (strain ATCC 15444)
C1DAK1 6.86e-49 166 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Laribacter hongkongensis (strain HLHK9)
A4X9Q4 7.01e-49 166 47 5 201 3 hisB Imidazoleglycerol-phosphate dehydratase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
P28624 7.66e-49 173 46 3 192 3 HIS3 Imidazoleglycerol-phosphate dehydratase Phytophthora nicotianae
Q1BS27 8.17e-49 166 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia orbicola (strain AU 1054)
A0K3V4 8.17e-49 166 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Burkholderia cenocepacia (strain HI2424)
B8I5V2 8.36e-49 166 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q82AA4 8.5e-49 166 47 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
C5D7P1 9.1e-49 166 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Geobacillus sp. (strain WCH70)
P61658 1.08e-48 165 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain ATCC 10987 / NRS 248)
P60885 1.24e-48 165 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q6HLE6 1.26e-48 165 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81T61 1.26e-48 165 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus anthracis
C3L9Q0 1.26e-48 165 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P503 1.26e-48 165 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus anthracis (strain A0248)
Q63DX1 1.44e-48 165 44 3 187 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus cereus (strain ZK / E33L)
B3Q8C2 1.57e-48 165 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodopseudomonas palustris (strain TIE-1)
Q0AW39 1.74e-48 165 43 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P58879 1.81e-48 165 46 4 194 3 hisB Imidazoleglycerol-phosphate dehydratase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q0VM69 2.02e-48 165 45 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q4ZLP8 2.28e-48 164 43 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas syringae pv. syringae (strain B728a)
Q87UG0 2.28e-48 164 43 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48C77 2.28e-48 164 43 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q5F7D6 2.72e-48 167 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1KV07 2.9e-48 167 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P64371 2.9e-48 167 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P64370 2.9e-48 167 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M186 2.9e-48 167 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Neisseria meningitidis serogroup C (strain 053442)
Q13E36 3.08e-48 164 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodopseudomonas palustris (strain BisB5)
Q01ZU4 3.4e-48 164 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Solibacter usitatus (strain Ellin6076)
P60887 3.61e-48 164 46 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q24QJ2 3.66e-48 164 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Desulfitobacterium hafniense (strain Y51)
A2RKS1 3.92e-48 164 47 6 198 3 hisB Imidazoleglycerol-phosphate dehydratase Lactococcus lactis subsp. cremoris (strain MG1363)
A0LQG8 4.38e-48 164 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B0VPC2 4.43e-48 164 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Acinetobacter baumannii (strain SDF)
A5USC4 4.46e-48 164 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Roseiflexus sp. (strain RS-1)
P16247 4.93e-48 164 46 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q5KVC7 5.39e-48 163 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Geobacillus kaustophilus (strain HTA426)
B0V8S1 7.49e-48 163 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Acinetobacter baumannii (strain AYE)
B3E4Y5 7.84e-48 163 46 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q39YP5 9.11e-48 163 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A4Y087 9.18e-48 163 43 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas mendocina (strain ymp)
A4G9I9 1.08e-47 163 42 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Herminiimonas arsenicoxydans
Q3SWE7 1.09e-47 162 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q07UQ5 1.11e-47 162 48 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodopseudomonas palustris (strain BisA53)
Q1QRX4 1.21e-47 162 47 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
P18787 1.28e-47 163 42 3 192 3 hisB Imidazoleglycerol-phosphate dehydratase Azospirillum brasilense
Q2FN13 1.58e-47 162 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q9K6Z3 2.17e-47 162 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
H9C4A4 2.39e-47 163 52 3 165 1 HIS3 Imidazoleglycerol-phosphate dehydratase Maudiozyma humilis
Q3KJI9 2.48e-47 162 43 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas fluorescens (strain Pf0-1)
Q6F7A8 2.74e-47 162 45 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A1ATG7 2.96e-47 161 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q1B7G6 3.68e-47 162 44 4 200 3 hisB Imidazoleglycerol-phosphate dehydratase Mycobacterium sp. (strain MCS)
A1UHK6 3.68e-47 162 44 4 200 3 hisB Imidazoleglycerol-phosphate dehydratase Mycobacterium sp. (strain KMS)
A3Q129 3.68e-47 162 44 4 200 3 hisB Imidazoleglycerol-phosphate dehydratase Mycobacterium sp. (strain JLS)
Q9HU41 3.98e-47 161 44 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EM2 3.98e-47 161 44 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3N7 3.98e-47 161 44 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas aeruginosa (strain LESB58)
A6VDR3 3.98e-47 161 44 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas aeruginosa (strain PA7)
O34683 4.55e-47 161 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus subtilis (strain 168)
Q1I3G4 4.67e-47 161 44 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas entomophila (strain L48)
Q2VYI7 4.81e-47 161 43 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A4VRW2 5.04e-47 161 43 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Stutzerimonas stutzeri (strain A1501)
A1T8W3 5.59e-47 161 42 4 203 3 hisB Imidazoleglycerol-phosphate dehydratase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A7NQZ5 5.86e-47 160 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A1WR21 6.19e-47 161 48 2 168 3 hisB Imidazoleglycerol-phosphate dehydratase Verminephrobacter eiseniae (strain EF01-2)
Q2J344 7.56e-47 160 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodopseudomonas palustris (strain HaA2)
A8LX62 7.88e-47 160 45 5 201 3 hisB Imidazoleglycerol-phosphate dehydratase Salinispora arenicola (strain CNS-205)
A6T379 8.22e-47 160 42 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Janthinobacterium sp. (strain Marseille)
B8G451 8.45e-47 160 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q2LVF5 8.69e-47 160 43 4 194 3 hisB Imidazoleglycerol-phosphate dehydratase Syntrophus aciditrophicus (strain SB)
Q5WDH9 1.06e-46 160 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Shouchella clausii (strain KSM-K16)
A4ISR5 1.28e-46 160 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Geobacillus thermodenitrificans (strain NG80-2)
B1JED5 1.48e-46 160 43 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas putida (strain W619)
Q6ANL7 1.53e-46 160 44 3 197 3 hisB Imidazoleglycerol-phosphate dehydratase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q7P0F3 1.57e-46 160 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A4YJV1 1.62e-46 160 47 2 167 3 hisB Imidazoleglycerol-phosphate dehydratase Bradyrhizobium sp. (strain ORS 278)
A0LTS3 1.69e-46 160 42 3 205 3 hisB Imidazoleglycerol-phosphate dehydratase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
C3K6U9 1.84e-46 159 43 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas fluorescens (strain SBW25)
B5YKN8 1.94e-46 159 43 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q12578 1.99e-46 160 45 5 208 3 HIS3 Imidazoleglycerol-phosphate dehydratase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
A7Z965 2.5e-46 159 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A8FHR2 2.99e-46 159 42 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Bacillus pumilus (strain SAFR-032)
Q9UVE1 3.5e-46 160 49 3 165 3 HIS3 Imidazoleglycerol-phosphate dehydratase Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229)
A8ETG3 4.3e-46 158 44 4 189 3 hisB Imidazoleglycerol-phosphate dehydratase Aliarcobacter butzleri (strain RM4018)
A1TKZ1 4.49e-46 159 46 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Paracidovorax citrulli (strain AAC00-1)
P06633 4.6e-46 159 48 3 166 1 HIS3 Imidazoleglycerol-phosphate dehydratase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P40374 4.96e-46 159 42 5 215 1 his5 Imidazoleglycerol-phosphate dehydratase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A7H8C1 5.38e-46 159 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Anaeromyxobacter sp. (strain Fw109-5)
Q21U94 5.75e-46 158 47 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q6CLR6 7.03e-46 159 49 3 165 3 HIS3 Imidazoleglycerol-phosphate dehydratase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
A4FYS8 7.99e-46 157 43 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Q75B47 1.06e-45 158 48 3 165 3 HIS3 Imidazoleglycerol-phosphate dehydratase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q02986 1.34e-45 158 49 3 165 3 HIS3 Imidazoleglycerol-phosphate dehydratase Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651)
A0QX83 1.45e-45 157 43 5 201 1 hisB Imidazoleglycerol-phosphate dehydratase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A6UN45 1.45e-45 157 42 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q6XD66 1.47e-45 158 48 3 165 3 HIS3 Imidazoleglycerol-phosphate dehydratase Torulaspora delbrueckii
O66455 1.51e-45 157 43 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Aquifex aeolicus (strain VF5)
Q1IKB4 1.73e-45 157 44 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Koribacter versatilis (strain Ellin345)
Q88R45 2.15e-45 157 43 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VX72 2.15e-45 157 43 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B9M0L7 2.46e-45 156 44 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A9A756 2.95e-45 156 43 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
B1I559 3.64e-45 156 44 3 192 3 hisB Imidazoleglycerol-phosphate dehydratase Desulforudis audaxviator (strain MP104C)
A6VJJ9 4.1e-45 156 42 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
P56090 4.29e-45 157 46 3 166 3 HIS3 Imidazoleglycerol-phosphate dehydratase Candida albicans
A5G8T2 4.47e-45 156 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Geotalea uraniireducens (strain Rf4)
O94126 4.56e-45 157 40 6 226 3 HIS3 Imidazoleglycerol-phosphate dehydratase Cyberlindnera jadinii
A5CZ77 5.84e-45 155 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A1W432 5.87e-45 156 46 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Acidovorax sp. (strain JS42)
B9MDV5 5.87e-45 156 46 3 195 3 hisB Imidazoleglycerol-phosphate dehydratase Acidovorax ebreus (strain TPSY)
C6BSE1 6.22e-45 155 43 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q96UK2 7e-45 156 46 4 184 2 HIS3 Imidazoleglycerol-phosphate dehydratase Zygosaccharomyces bailii
P60888 7.39e-45 155 43 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q92447 1.02e-44 156 48 3 166 3 HIS3 Imidazoleglycerol-phosphate dehydratase Komagataella pastoris
Q47QS7 1.4e-44 155 47 5 195 3 hisB Imidazoleglycerol-phosphate dehydratase Thermobifida fusca (strain YX)
C0QUG8 1.78e-44 154 45 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Persephonella marina (strain DSM 14350 / EX-H1)
P60884 2.11e-44 154 43 6 204 3 hisB Imidazoleglycerol-phosphate dehydratase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B5EDR7 2.69e-44 154 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B0KI41 3.08e-44 154 43 4 196 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudomonas putida (strain GB-1)
B2UL23 3.12e-44 154 43 4 195 3 hisB Imidazoleglycerol-phosphate dehydratase Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
A5FYE1 3.9e-44 153 45 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Acidiphilium cryptum (strain JF-5)
C6E7F7 3.99e-44 153 44 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Geobacter sp. (strain M21)
Q9HN13 7.48e-44 153 44 2 194 3 hisB Imidazoleglycerol-phosphate dehydratase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R7J1 7.48e-44 153 44 2 194 3 hisB Imidazoleglycerol-phosphate dehydratase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
A4YI33 1.03e-43 152 45 4 193 3 hisB Imidazoleglycerol-phosphate dehydratase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Q2INV5 1.24e-43 152 44 4 189 3 hisB Imidazoleglycerol-phosphate dehydratase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q9RX91 3.34e-43 151 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q6A8L3 3.65e-43 151 42 6 202 3 hisB Imidazoleglycerol-phosphate dehydratase Cutibacterium acnes (strain DSM 16379 / KPA171202)
A8M909 3.74e-43 150 41 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167)
A0JUZ5 4.44e-43 151 40 5 205 3 hisB Imidazoleglycerol-phosphate dehydratase Arthrobacter sp. (strain FB24)
Q9C1D4 5.66e-43 151 46 3 166 3 HIS3 Imidazoleglycerol-phosphate dehydratase Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q58109 6.3e-43 150 45 3 189 3 hisB Imidazoleglycerol-phosphate dehydratase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A9WQ57 8.79e-43 150 42 5 199 3 hisB Imidazoleglycerol-phosphate dehydratase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
O42621 9.15e-43 151 47 4 168 3 PTH3 Imidazoleglycerol-phosphate dehydratase Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
A0RQ64 1.19e-42 149 42 4 186 3 hisB Imidazoleglycerol-phosphate dehydratase Campylobacter fetus subsp. fetus (strain 82-40)
A8ZUC7 1.21e-42 149 40 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
A6Q330 1.22e-42 149 41 4 189 3 hisB Imidazoleglycerol-phosphate dehydratase Nitratiruptor sp. (strain SB155-2)
A1SL60 1.27e-42 150 41 4 200 3 hisB Imidazoleglycerol-phosphate dehydratase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q0SHY0 1.53e-42 149 42 5 203 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodococcus jostii (strain RHA1)
C1A0M3 1.56e-42 149 41 6 204 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
C1ATZ4 1.74e-42 149 42 5 203 3 hisB Imidazoleglycerol-phosphate dehydratase Rhodococcus opacus (strain B4)
Q03VX7 1.9e-42 149 42 3 190 3 hisB Imidazoleglycerol-phosphate dehydratase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A1R559 2.1e-42 149 41 5 199 3 hisB Imidazoleglycerol-phosphate dehydratase Paenarthrobacter aurescens (strain TC1)
P64374 3.59e-42 148 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain MW2)
A8Z5H6 3.59e-42 148 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G5Z9 3.59e-42 148 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain MSSA476)
P64373 3.59e-42 148 41 4 187 1 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain N315)
P64372 3.59e-42 148 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QKG4 3.59e-42 148 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain Newman)
Q5HCM1 3.59e-42 148 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain COL)
A5IWA3 3.59e-42 148 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain JH9)
Q2FUU0 3.59e-42 148 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FDI5 3.59e-42 148 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain USA300)
A6U561 3.59e-42 148 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain JH1)
A7X766 3.59e-42 148 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain Mu3 / ATCC 700698)
B8HGA0 4.53e-42 149 41 5 199 3 hisB Imidazoleglycerol-phosphate dehydratase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q2YZ91 5.15e-42 148 41 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain bovine RF122 / ET3-1)
B8JDL0 5.31e-42 148 44 4 185 3 hisB Imidazoleglycerol-phosphate dehydratase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A7GXG2 6.68e-42 147 42 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Campylobacter curvus (strain 525.92)
Q1IZQ5 7.11e-42 148 42 3 197 3 hisB Imidazoleglycerol-phosphate dehydratase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
B4UDJ7 8.13e-42 148 44 4 185 3 hisB Imidazoleglycerol-phosphate dehydratase Anaeromyxobacter sp. (strain K)
P60886 9.67e-42 147 42 5 192 3 hisB Imidazoleglycerol-phosphate dehydratase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QHI0 9.67e-42 147 42 5 192 3 hisB Imidazoleglycerol-phosphate dehydratase Mycobacterium avium (strain 104)
Q3A134 1.06e-41 147 41 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q5HKN9 1.48e-41 147 40 5 190 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
C3N6A7 1.71e-41 146 42 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Sulfolobus islandicus (strain M.16.27)
Q8CQ94 1.85e-41 146 40 5 190 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A5CSK8 2.4e-41 146 43 5 197 3 hisB Imidazoleglycerol-phosphate dehydratase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
A6UTB1 2.4e-41 146 42 3 191 3 hisB Imidazoleglycerol-phosphate dehydratase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q4A046 2.6e-41 146 40 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
C3NGY0 2.8e-41 146 41 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
C3MQI6 2.8e-41 146 41 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
A7I064 3.8e-41 145 43 4 186 3 hisB Imidazoleglycerol-phosphate dehydratase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B0RHB5 4.08e-41 146 43 5 197 3 hisB Imidazoleglycerol-phosphate dehydratase Clavibacter sepedonicus
C3MW64 4.66e-41 145 41 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C4KHS1 4.66e-41 145 41 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
A7ZEG5 5.21e-41 145 41 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Campylobacter concisus (strain 13826)
C3NER4 5.41e-41 145 41 2 191 3 hisB Imidazoleglycerol-phosphate dehydratase Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
A6Q9M2 6.6e-41 145 41 4 189 3 hisB Imidazoleglycerol-phosphate dehydratase Sulfurovum sp. (strain NBC37-1)
Q7VGJ6 7.87e-41 145 41 5 193 3 hisB Imidazoleglycerol-phosphate dehydratase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q6GDC8 7.96e-41 145 40 4 187 3 hisB Imidazoleglycerol-phosphate dehydratase Staphylococcus aureus (strain MRSA252)
Q6JV40 8.06e-41 145 46 3 165 3 HIS3 Imidazoleglycerol-phosphate dehydratase Kluyveromyces marxianus
B8DSW4 1.18e-40 144 41 6 199 3 hisB Imidazoleglycerol-phosphate dehydratase Bifidobacterium animalis subsp. lactis (strain AD011)
Q5SL64 1.33e-40 144 43 3 193 3 hisB Imidazoleglycerol-phosphate dehydratase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
C1D1S1 1.97e-40 144 40 3 194 3 hisB Imidazoleglycerol-phosphate dehydratase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
C4XSN6 2.28e-40 144 40 3 192 3 hisB Imidazoleglycerol-phosphate dehydratase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q9HEG3 2.54e-40 144 46 4 168 3 65E11.030 Imidazoleglycerol-phosphate dehydratase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_09090
Feature type CDS
Gene hisB
Product bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB
Location 52273 - 53340 (strand: -1)
Length 1068 (nucleotides) / 355 (amino acids)
In genomic island -

Contig

Accession ZDB_686
Length 191111 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1255
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00475 Imidazoleglycerol-phosphate dehydratase
PF13242 HAD-hyrolase-like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0131 Amino acid transport and metabolism (E) E Imidazoleglycerol phosphate dehydratase HisB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01089 imidazoleglycerol-phosphate dehydratase / histidinol-phosphatase [EC:4.2.1.19 3.1.3.15] Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Histidine biosynthesis, PRPP => histidine

Protein Sequence

MTQNVLFIDRDGTLITEPPVDFQVDRLDKLAFEPDVIPALLKLKEAGYRFVMVTNQDGLGTDSFPQADFEAPHQLMMQIFTSQGITFDEVLICPHKPADNCNCRKPKITLVEKYLLPGVIDAKNSYVIGDRETDIQLAENMGITGLRYGQPDTDWNSIAEQLTRRDRYSRVERRTKETDILTEVWLDREGGSTIRTGVGFFDHMLDQIATHGGFRLNIQVSGDLVIDDHHTVEDTGLALGEALKLALGDKRGITRFGFTLPMDECLARCALDISGRPHLEYKADFKYQRVGDLSTEMIEHFFRSLSYTMGCTLHLKTKGKNDHHRAESLFKVFGRTLRQAIRVEGNVLPSSKGVL

Flanking regions ( +/- flanking 50bp)

CACCGCTATCGCCGCGCTTGAAATGCCATAATCTGAGGACAACGGATACCATGACACAGAACGTTTTATTTATTGACCGCGACGGCACTCTGATCACCGAACCACCGGTGGATTTTCAGGTGGACAGATTAGACAAACTGGCTTTTGAGCCGGATGTGATCCCCGCGCTGCTGAAGCTGAAAGAGGCCGGATACCGCTTTGTGATGGTCACCAACCAGGACGGACTGGGTACAGACAGTTTCCCGCAGGCGGATTTCGAGGCACCGCACCAGCTGATGATGCAGATTTTCACCTCTCAGGGCATTACCTTTGATGAGGTGCTGATTTGTCCGCACAAACCGGCGGATAATTGCAACTGCCGCAAACCGAAAATCACGCTGGTGGAAAAATACCTGCTGCCGGGCGTTATTGACGCGAAAAACAGCTATGTGATCGGCGATCGTGAAACTGACATTCAGCTCGCGGAAAACATGGGCATTACCGGCCTGCGTTACGGCCAGCCGGACACTGACTGGAACAGTATCGCAGAGCAGCTGACCCGCCGTGACCGTTACAGCCGCGTGGAGCGCAGAACCAAAGAGACCGATATTCTCACCGAAGTATGGCTCGACCGCGAAGGCGGCAGCACCATCCGCACCGGTGTCGGCTTTTTCGATCACATGCTGGATCAGATTGCCACCCACGGCGGTTTCCGCCTCAATATTCAGGTCAGCGGCGACCTGGTGATTGATGATCACCACACCGTGGAAGATACCGGACTGGCGCTGGGCGAAGCCCTGAAACTGGCACTCGGCGATAAGCGCGGTATCACCCGTTTCGGCTTTACCCTGCCGATGGATGAGTGTCTTGCCCGCTGCGCTCTGGATATCTCCGGCCGTCCGCACCTGGAATACAAAGCCGATTTTAAATATCAGCGTGTCGGCGACCTGAGCACTGAGATGATTGAGCACTTCTTCCGCTCGCTCTCCTATACCATGGGCTGCACGTTACACCTGAAAACCAAAGGGAAGAACGACCACCACAGAGCCGAAAGCCTGTTTAAAGTGTTCGGACGGACACTGCGCCAGGCTATCCGTGTGGAAGGTAATGTTCTGCCGAGTTCAAAAGGGGTGCTGTGATGCACATAGTGATCACCGATACCGGCTGTGCCAATATCGCCTCCGTCCGC