Homologs in group_1553

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09735 FBDBKF_09735 96.3 Morganella morganii S1 pal peptidoglycan-associated lipoprotein Pal
EHELCC_04535 EHELCC_04535 96.3 Morganella morganii S2 pal peptidoglycan-associated lipoprotein Pal
NLDBIP_04535 NLDBIP_04535 96.3 Morganella morganii S4 pal peptidoglycan-associated lipoprotein Pal
LHKJJB_14095 LHKJJB_14095 96.3 Morganella morganii S3 pal peptidoglycan-associated lipoprotein Pal
HKOGLL_12440 HKOGLL_12440 96.3 Morganella morganii S5 pal peptidoglycan-associated lipoprotein Pal
PMI_RS02875 PMI_RS02875 75.0 Proteus mirabilis HI4320 pal peptidoglycan-associated lipoprotein Pal

Distribution of the homologs in the orthogroup group_1553

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1553

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A914 1.54e-81 241 75 3 173 3 pal Peptidoglycan-associated lipoprotein Shigella flexneri
P0A912 1.54e-81 241 75 3 173 1 pal Peptidoglycan-associated lipoprotein Escherichia coli (strain K12)
P0A913 1.54e-81 241 75 3 173 3 pal Peptidoglycan-associated lipoprotein Escherichia coli O157:H7
P10324 9.92e-58 180 58 2 162 1 pal Peptidoglycan-associated lipoprotein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q51886 4.3e-55 173 56 3 162 3 pal Peptidoglycan-associated lipoprotein Pasteurella multocida (strain Pm70)
Q89AJ5 4.03e-36 126 35 3 173 3 pal Peptidoglycan-associated lipoprotein Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P26493 7.44e-30 110 37 4 165 3 pal Peptidoglycan-associated lipoprotein Legionella pneumophila
Q9I4Z4 4.78e-29 107 42 3 147 3 pal Peptidoglycan-associated lipoprotein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A3S8 7.7e-29 107 38 2 149 1 pal Peptidoglycan-associated lipoprotein Brucella suis biovar 1 (strain 1330)
P0A3S7 7.7e-29 107 38 2 149 1 pal Peptidoglycan-associated lipoprotein Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P0A3S9 7.7e-29 107 38 2 149 1 pal Peptidoglycan-associated lipoprotein Brucella abortus biovar 1 (strain 9-941)
P0A139 1.29e-27 103 42 3 145 3 pal Peptidoglycan-associated lipoprotein Pseudomonas putida
P0A138 1.29e-27 103 42 3 145 3 pal Peptidoglycan-associated lipoprotein Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q98F85 1.25e-23 94 40 3 155 3 pal Peptidoglycan-associated lipoprotein Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q926C3 1.05e-22 91 41 2 155 3 pal Peptidoglycan-associated lipoprotein Rhizobium meliloti (strain 1021)
Q8U9L5 5.52e-20 84 46 0 102 3 pal Peptidoglycan-associated lipoprotein Agrobacterium fabrum (strain C58 / ATCC 33970)
P22263 8.95e-13 67 34 5 161 3 oprF Outer membrane porin F Pseudomonas syringae pv. syringae
P13794 1.88e-11 64 33 5 159 1 oprF Outer membrane porin F Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q05146 2.46e-11 62 37 0 98 3 ompA Outer membrane protein A Bordetella avium
P38368 7.18e-10 59 35 2 104 1 ompA Outer membrane protein P5 Haemophilus influenzae
P43840 8.55e-10 59 35 2 104 3 ompA Outer membrane protein P5 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P37726 1.72e-09 58 37 0 98 1 oprF Outer membrane porin F Pseudomonas fluorescens
P38399 2e-09 58 39 4 103 1 ompA Outer membrane protein A Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZG77 2e-09 58 39 4 103 1 ompA Outer membrane protein A Yersinia pestis
P9WIU5 4.12e-09 57 33 0 102 1 arfA Peptidoglycan-binding protein ArfA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIU4 4.12e-09 57 33 0 102 3 arfA Peptidoglycan-binding protein ArfA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A1KH31 4.12e-09 57 33 0 102 1 arfA Peptidoglycan-binding protein ArfA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P65594 4.12e-09 57 33 0 102 3 arfA Peptidoglycan-binding protein ArfA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P45996 1.72e-08 55 33 2 104 1 ompA Outer membrane protein P5 Haemophilus influenzae
Q9I4L6 4.82e-08 53 29 1 141 1 yfiB Outer-membrane lipoprotein YfiB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A0V3 9.63e-08 53 38 0 93 1 rmpM Outer membrane protein class 4 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P07050 1.26e-07 52 37 0 93 3 None Outer membrane protein P.III Neisseria gonorrhoeae
P0A0V2 2.08e-07 52 38 0 93 3 rmpM Outer membrane protein class 4 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q7NFT5 2.87e-07 52 34 1 85 1 psaB Photosystem I P700 chlorophyll a apoprotein A2 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
P0C8Z2 2.98e-07 51 37 4 103 3 ompA Outer membrane protein A (Fragment) Escherichia fergusonii
P24016 3.31e-07 51 37 4 103 3 ompA Outer membrane protein A (Fragment) Citrobacter freundii
P24754 4.54e-07 51 37 4 103 3 ompA Outer membrane protein A (Fragment) Atlantibacter hermannii
B7LNW7 7.93e-07 50 37 4 103 3 ompA Outer membrane protein A Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P02935 8.64e-07 50 37 4 103 3 ompA Outer membrane protein A Shigella dysenteriae
P0A910 9.72e-07 50 37 4 103 1 ompA Outer membrane protein A Escherichia coli (strain K12)
P0A911 9.72e-07 50 37 4 103 3 ompA Outer membrane protein A Escherichia coli O157:H7
A0A2S4N3N0 1.02e-06 50 37 4 103 1 ompA Outer membrane protein A Shigella flexneri
Q8Z7S0 1.16e-06 50 37 4 103 3 ompA Outer membrane protein A Salmonella typhi
P02936 1.23e-06 50 37 4 103 3 ompA Outer membrane protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P09146 2.42e-06 49 36 4 103 3 ompA Outer membrane protein A Klebsiella aerogenes
P0DJO6 2.02e-05 46 35 4 103 3 ompA Outer membrane protein A (Fragment) Shimwellia blattae
P24017 2.32e-05 46 36 4 103 1 ompA Outer membrane protein A Klebsiella pneumoniae
P07021 3.69e-05 45 28 1 106 3 yfiB Putative lipoprotein YfiB Escherichia coli (strain K12)
I2BAK7 3.92e-05 45 29 5 158 3 ompA Outer membrane protein A Shimwellia blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 105725 / CDC 9005-74)
P37665 0.000332 42 26 1 124 1 yiaD Probable lipoprotein YiaD Escherichia coli (strain K12)
P57414 0.000454 42 39 0 51 3 ompA Outer membrane protein A Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P04845 0.000513 42 37 3 91 3 ompA Outer membrane protein A Serratia marcescens
Q8K9L4 0.000661 42 40 0 49 3 ompA Outer membrane protein A Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS00605
Feature type CDS
Gene pal
Product peptidoglycan-associated lipoprotein Pal
Location 128634 - 129128 (strand: 1)
Length 495 (nucleotides) / 164 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1553
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00691 OmpA family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2885 Cell wall/membrane/envelope biogenesis (M) M Outer membrane protein OmpA and related peptidoglycan-associated (lipo)proteins

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03640 peptidoglycan-associated lipoprotein - -

Protein Sequence

MQLNKVLKGLMIALPVLAVAACSSNKNDQADAGTVDNSANTGMSAEDLARQQLQELQNNNIVYFGFDKYDISPEFQQLLDAHAAFLRNNPSYKVTVEGHADERGTPEYNIALGERRANAAKMYLQGKGVNGEQISIVSYGKEKPAVLGHTEADYAKNRRAVLVY

Flanking regions ( +/- flanking 50bp)

ATCTGTGATGCATTAAAATATGTATGGCAAATTATAAAAGGATCAAAGAGATGCAACTTAACAAAGTGCTTAAAGGGCTGATGATAGCTTTACCTGTTCTGGCCGTCGCTGCATGTAGTTCTAACAAAAACGACCAGGCTGATGCGGGCACTGTCGACAATAGCGCAAACACTGGTATGTCAGCTGAAGATCTGGCTCGCCAGCAACTTCAGGAACTTCAGAACAACAATATCGTATACTTCGGTTTCGACAAATACGACATTTCTCCTGAATTCCAACAGCTGCTGGACGCGCACGCTGCATTCCTGCGTAACAACCCGTCTTACAAAGTGACTGTTGAAGGTCATGCTGATGAGCGTGGTACTCCGGAATACAACATCGCACTGGGCGAACGTCGTGCTAACGCTGCTAAGATGTATCTGCAGGGTAAAGGCGTGAACGGTGAACAAATCTCTATCGTTTCTTACGGTAAAGAAAAACCAGCAGTTCTGGGTCACACCGAAGCTGACTACGCGAAAAATCGTCGCGCAGTACTGGTATACTAAGAGATATACATGAAAAGTAACTTCAGACGCCTGATGGTGAGTCTGTCGTT