Homologs in group_2476

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20505 FBDBKF_20505 100.0 Morganella morganii S1 - MmcQ-like protein
NLDBIP_19835 NLDBIP_19835 100.0 Morganella morganii S4 - MmcQ-like protein
LHKJJB_19790 LHKJJB_19790 100.0 Morganella morganii S3 - MmcQ-like protein
HKOGLL_19675 HKOGLL_19675 100.0 Morganella morganii S5 - MmcQ-like protein
F4V73_RS01625 F4V73_RS01625 69.3 Morganella psychrotolerans - MmcQ/YjbR family DNA-binding protein
PMI_RS04800 PMI_RS04800 50.7 Proteus mirabilis HI4320 - MmcQ/YjbR family DNA-binding protein

Distribution of the homologs in the orthogroup group_2476

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2476

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37507 1.01e-13 63 40 1 74 4 yyaQ Uncharacterized protein YyaQ Bacillus subtilis (strain 168)
P0AAT2 1.51e-06 45 35 1 59 4 ybdF Uncharacterized protein YbdF Escherichia coli (strain K12)
P0AAT3 1.51e-06 45 35 1 59 4 ybdF Uncharacterized protein YbdF Escherichia coli O157:H7
P0AF50 7.55e-06 43 35 1 54 1 yjbR Uncharacterized protein YjbR Escherichia coli (strain K12)
P0AF51 7.55e-06 43 35 1 54 4 yjbR Uncharacterized protein YjbR Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_19790
Feature type CDS
Gene -
Product MmcQ-like protein
Location 212 - 439 (strand: 1)
Length 228 (nucleotides) / 75 (amino acids)
In genomic island -

Contig

Accession ZDB_256
Length 2881 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2476
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04237 YjbR

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2315 Transcription (K) K Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family

Protein Sequence

MSVSADKIGAGDAEKVVDIVNVKAAPEMVGSLRLKDGIYPAYHMNKEHWVTIILDAEFSSEELKSLIDDSYRLTW

Flanking regions ( +/- flanking 50bp)

ATTATGCGGTATTCAGGCACCGCGGAAATGCCAAATGGTTTGCTATCATAATGTCAGTATCTGCTGATAAAATAGGCGCCGGAGACGCAGAGAAAGTAGTGGATATTGTTAATGTTAAGGCTGCGCCGGAAATGGTTGGCTCTCTTCGTTTAAAGGATGGTATCTATCCTGCGTATCACATGAACAAAGAACACTGGGTTACGATAATACTGGATGCTGAGTTCAGTAGTGAAGAACTGAAGTCATTAATTGATGATAGTTACAGACTGACCTGGTAACGATAATTTACAGGATAAACTCTCCGCAATTCCTTGATAGTTAGCATGTT