Homologs in group_2448

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20350 FBDBKF_20350 100.0 Morganella morganii S1 coaA type I pantothenate kinase
NLDBIP_19665 NLDBIP_19665 100.0 Morganella morganii S4 coaA type I pantothenate kinase
LHKJJB_19635 LHKJJB_19635 100.0 Morganella morganii S3 coaA type I pantothenate kinase
HKOGLL_19545 HKOGLL_19545 100.0 Morganella morganii S5 coaA type I pantothenate kinase
F4V73_RS18875 F4V73_RS18875 96.8 Morganella psychrotolerans coaA type I pantothenate kinase
PMI_RS16100 PMI_RS16100 75.8 Proteus mirabilis HI4320 coaA type I pantothenate kinase

Distribution of the homologs in the orthogroup group_2448

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2448

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MYE7 0.0 514 77 0 307 3 coaA Pantothenate kinase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JJI8 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FR1 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TR20 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pestis (strain Pestoides F)
Q1CN90 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R361 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAN6 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pestis
B2K103 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2D3 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNJ3 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8G8D9 0.0 506 76 1 313 3 coaA Pantothenate kinase Serratia proteamaculans (strain 568)
A1JIH1 2.66e-180 503 75 1 313 3 coaA Pantothenate kinase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DHQ6 4.97e-180 502 75 1 313 3 coaA Pantothenate kinase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5XYG3 2.96e-178 498 74 1 313 1 coaA Pantothenate kinase Klebsiella pneumoniae (strain 342)
A7MQP3 3.89e-178 497 75 0 307 3 coaA Pantothenate kinase Cronobacter sakazakii (strain ATCC BAA-894)
Q6DAN8 4.59e-178 497 75 1 313 3 coaA Pantothenate kinase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6TGN1 5.78e-178 497 74 1 313 3 coaA Pantothenate kinase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q9L9K3 8.29e-178 496 74 1 313 3 coaA Pantothenate kinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C0Q2Q8 8.29e-178 496 74 1 313 3 coaA Pantothenate kinase Salmonella paratyphi C (strain RKS4594)
A9N0I2 8.29e-178 496 74 1 313 3 coaA Pantothenate kinase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TCR5 8.29e-178 496 74 1 313 3 coaA Pantothenate kinase Salmonella heidelberg (strain SL476)
B5QXR5 8.29e-178 496 74 1 313 3 coaA Pantothenate kinase Salmonella enteritidis PT4 (strain P125109)
B5FPY5 8.29e-178 496 74 1 313 3 coaA Pantothenate kinase Salmonella dublin (strain CT_02021853)
Q57H79 8.29e-178 496 74 1 313 3 coaA Pantothenate kinase Salmonella choleraesuis (strain SC-B67)
Q8Z318 8.57e-178 496 74 1 313 3 coaA Pantothenate kinase Salmonella typhi
B4TQI6 8.57e-178 496 74 1 313 3 coaA Pantothenate kinase Salmonella schwarzengrund (strain CVM19633)
B5BJP4 8.57e-178 496 74 1 313 3 coaA Pantothenate kinase Salmonella paratyphi A (strain AKU_12601)
Q5PK80 8.57e-178 496 74 1 313 3 coaA Pantothenate kinase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0Y0 8.57e-178 496 74 1 313 3 coaA Pantothenate kinase Salmonella newport (strain SL254)
B5F0V8 8.57e-178 496 74 1 313 3 coaA Pantothenate kinase Salmonella agona (strain SL483)
Q2NWS4 3.64e-177 495 75 0 307 3 coaA Pantothenate kinase Sodalis glossinidius (strain morsitans)
B5RFK9 6.09e-177 494 74 1 313 3 coaA Pantothenate kinase Salmonella gallinarum (strain 287/91 / NCTC 13346)
A8AKV0 4.81e-176 492 73 1 315 3 coaA Pantothenate kinase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2VG89 5.57e-176 492 75 1 316 3 coaA Pantothenate kinase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q83PC5 6.35e-176 492 73 1 313 3 coaA Pantothenate kinase Shigella flexneri
B1LNT0 6.49e-176 492 73 1 313 3 coaA Pantothenate kinase Escherichia coli (strain SMS-3-5 / SECEC)
B7NFR9 6.49e-176 492 73 1 313 3 coaA Pantothenate kinase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A4W599 8.08e-176 491 74 1 313 3 coaA Pantothenate kinase Enterobacter sp. (strain 638)
Q3YV06 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Shigella sonnei (strain Ss046)
B7LUM3 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R5X9 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli (strain UTI89 / UPEC)
P0A6I3 8.36e-176 491 73 1 313 1 coaA Pantothenate kinase Escherichia coli (strain K12)
P0A6I4 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA86 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AIF2 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli O1:K1 / APEC
A8A778 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli O9:H4 (strain HS)
B1XBY1 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli (strain K12 / DH10B)
C5A0R9 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M726 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli O8 (strain IAI1)
B7MR65 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli O81 (strain ED1a)
B7NR61 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0A6I5 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli O157:H7
B7LA72 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli (strain 55989 / EAEC)
B7MIW5 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UNV0 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUJ0 8.36e-176 491 73 1 313 3 coaA Pantothenate kinase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31U19 8.71e-175 489 73 1 313 3 coaA Pantothenate kinase Shigella boydii serotype 4 (strain Sb227)
B2TWG4 8.71e-175 489 73 1 313 3 coaA Pantothenate kinase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q32AF0 1.51e-174 488 73 1 313 3 coaA Pantothenate kinase Shigella dysenteriae serotype 1 (strain Sd197)
C4K6Z7 7.19e-172 481 73 0 305 3 coaA Pantothenate kinase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B3GYJ4 8.32e-158 446 64 0 314 3 coaA Pantothenate kinase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BRA6 1.29e-157 446 64 0 314 3 coaA Pantothenate kinase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N2G1 1.29e-157 446 64 0 314 3 coaA Pantothenate kinase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VPK9 1.86e-155 440 64 0 310 3 coaA Pantothenate kinase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P57967 6.02e-151 429 66 1 308 3 coaA Pantothenate kinase Pasteurella multocida (strain Pm70)
P44793 5.97e-147 418 64 1 307 3 coaA Pantothenate kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KV38 1.64e-146 417 64 1 311 3 coaA Pantothenate kinase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A3Q967 1.41e-145 415 64 0 305 3 coaA Pantothenate kinase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q65QG5 8.47e-144 410 62 1 310 3 coaA Pantothenate kinase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1T0P0 5.26e-143 409 61 0 305 3 coaA Pantothenate kinase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q7MGQ9 1.4e-141 404 60 1 308 3 coaA Pantothenate kinase Vibrio vulnificus (strain YJ016)
Q0I1U8 1.92e-141 404 62 1 308 3 coaA Pantothenate kinase Histophilus somni (strain 129Pt)
A6VKH8 2.47e-141 404 62 1 307 3 coaA Pantothenate kinase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0UV22 2.98e-141 404 62 1 308 3 coaA Pantothenate kinase Histophilus somni (strain 2336)
Q8DD30 4.34e-140 400 60 1 308 3 coaA Pantothenate kinase Vibrio vulnificus (strain CMCP6)
Q8EK83 3.9e-139 399 61 0 305 3 coaA Pantothenate kinase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8GYW1 1.3e-138 397 63 0 305 3 coaA Pantothenate kinase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B8CNB7 1.79e-138 397 63 0 305 3 coaA Pantothenate kinase Shewanella piezotolerans (strain WP3 / JCM 13877)
A0KRK9 6.28e-138 395 61 0 305 3 coaA Pantothenate kinase Shewanella sp. (strain ANA-3)
B0TM27 8.91e-138 395 62 0 305 3 coaA Pantothenate kinase Shewanella halifaxensis (strain HAW-EB4)
A6WHR3 2.87e-137 394 60 0 305 3 coaA Pantothenate kinase Shewanella baltica (strain OS185)
A3DA75 2.87e-137 394 60 0 305 3 coaA Pantothenate kinase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBM0 2.87e-137 394 60 0 305 3 coaA Pantothenate kinase Shewanella baltica (strain OS223)
A9KW87 3.27e-137 394 60 0 305 3 coaA Pantothenate kinase Shewanella baltica (strain OS195)
A1RE99 4.4e-137 394 60 0 305 3 coaA Pantothenate kinase Shewanella sp. (strain W3-18-1)
A4YBZ8 4.4e-137 394 60 0 305 3 coaA Pantothenate kinase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8G1G2 8.38e-137 393 61 0 305 3 coaA Pantothenate kinase Shewanella sediminis (strain HAW-EB3)
Q089R9 8.48e-137 393 60 0 305 3 coaA Pantothenate kinase Shewanella frigidimarina (strain NCIMB 400)
Q0HNV3 1.99e-136 392 60 0 305 3 coaA Pantothenate kinase Shewanella sp. (strain MR-4)
Q0I0C1 2.19e-136 392 60 0 305 3 coaA Pantothenate kinase Shewanella sp. (strain MR-7)
B1KMZ8 1e-135 390 60 0 305 3 coaA Pantothenate kinase Shewanella woodyi (strain ATCC 51908 / MS32)
A1S203 4.38e-135 388 60 0 305 3 coaA Pantothenate kinase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q12SX3 1.12e-132 382 58 0 305 3 coaA Pantothenate kinase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
C0Z7P4 6.73e-131 378 58 1 309 3 coaA Pantothenate kinase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A7HSG6 2.32e-125 364 55 0 310 3 coaA Pantothenate kinase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q07UR1 2.39e-125 363 56 0 307 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain BisA53)
Q1D9X8 2.59e-124 361 53 1 316 3 coaA Pantothenate kinase Myxococcus xanthus (strain DK1622)
A5E8E3 1.44e-122 357 54 0 311 3 coaA Pantothenate kinase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A8HYS9 1.6e-122 357 54 2 314 3 coaA Pantothenate kinase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q2J338 3.57e-122 356 55 0 307 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain HaA2)
Q13E42 8.1e-122 355 55 0 307 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain BisB5)
Q1QRW8 1.38e-121 354 54 0 312 3 coaA Pantothenate kinase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q21CJ9 1.4e-121 354 54 0 307 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain BisB18)
C1AYH1 1.49e-121 354 55 3 316 3 coaA Pantothenate kinase Rhodococcus opacus (strain B4)
Q0S4A2 2.78e-121 353 54 3 316 3 coaA Pantothenate kinase Rhodococcus jostii (strain RHA1)
B6JCG7 4.55e-121 353 54 0 306 3 coaA Pantothenate kinase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A4YJV7 4.8e-121 353 54 0 311 3 coaA Pantothenate kinase Bradyrhizobium sp. (strain ORS 278)
Q3SWF3 6.59e-121 352 54 0 311 3 coaA Pantothenate kinase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q89WM2 1.74e-120 351 54 0 311 3 coaA Pantothenate kinase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A9KD67 2.91e-120 351 52 0 308 3 coaA Pantothenate kinase Coxiella burnetii (strain Dugway 5J108-111)
Q83EV9 4.31e-120 350 52 0 308 1 coaA Pantothenate kinase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAJ3 1.56e-119 349 52 0 308 3 coaA Pantothenate kinase Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J2J7 1.56e-119 349 52 0 308 3 coaA Pantothenate kinase Coxiella burnetii (strain CbuG_Q212)
B6J596 1.56e-119 349 52 0 308 3 coaA Pantothenate kinase Coxiella burnetii (strain CbuK_Q154)
B3Q953 2.32e-119 348 53 0 307 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain TIE-1)
Q6ND01 2.32e-119 348 53 0 307 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q5YQ72 3.11e-119 348 53 3 316 3 coaA Pantothenate kinase Nocardia farcinica (strain IFM 10152)
O86779 1.79e-118 347 52 1 309 3 coaA Pantothenate kinase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q4JU68 4.22e-118 345 53 2 309 3 coaA Pantothenate kinase Corynebacterium jeikeium (strain K411)
Q82DL5 8.61e-118 345 52 1 309 3 coaA Pantothenate kinase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
C1A2X7 9.93e-118 344 53 3 316 3 coaA Pantothenate kinase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q11CK5 2.13e-117 343 53 4 312 3 coaA Pantothenate kinase Chelativorans sp. (strain BNC1)
B5ZV89 3.93e-117 343 53 5 318 3 coaA Pantothenate kinase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q6NI48 4.18e-117 342 53 1 314 3 coaA Pantothenate kinase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q47LM9 4.26e-117 343 53 2 313 3 coaA Pantothenate kinase Thermobifida fusca (strain YX)
B3PWH7 4.68e-117 343 53 5 318 3 coaA Pantothenate kinase Rhizobium etli (strain CIAT 652)
A9FRP1 1.95e-116 341 53 1 309 3 coaA Pantothenate kinase Sorangium cellulosum (strain So ce56)
Q9K8X7 3.44e-116 340 54 2 308 3 coaA Pantothenate kinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A4QCW5 4.75e-116 340 53 3 313 3 coaA Pantothenate kinase Corynebacterium glutamicum (strain R)
Q5WEY6 5.38e-116 340 54 1 310 3 coaA Pantothenate kinase Shouchella clausii (strain KSM-K16)
Q1MNG0 7.16e-116 340 52 5 318 3 coaA Pantothenate kinase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B1MKN0 1.7e-115 338 54 3 309 3 coaA Pantothenate kinase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q8NRQ2 1.76e-115 338 53 3 313 3 coaA Pantothenate kinase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
C3PFC1 2.33e-115 338 53 2 314 3 coaA Pantothenate kinase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q8FQR2 5.62e-115 338 52 3 318 3 coaA Pantothenate kinase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A1SF33 1.81e-114 337 52 1 308 3 coaA Pantothenate kinase Nocardioides sp. (strain ATCC BAA-499 / JS614)
A4T9A9 1.86e-114 336 54 3 311 3 coaA Pantothenate kinase Mycolicibacterium gilvum (strain PYR-GCK)
Q1B4E6 2.19e-114 336 53 3 311 3 coaA Pantothenate kinase Mycobacterium sp. (strain MCS)
A1UKP2 2.19e-114 336 53 3 311 3 coaA Pantothenate kinase Mycobacterium sp. (strain KMS)
A3Q4Q8 2.19e-114 336 53 3 311 3 coaA Pantothenate kinase Mycobacterium sp. (strain JLS)
Q73WG0 2.29e-114 336 54 3 311 3 coaA Pantothenate kinase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
B9JXX1 2.65e-114 336 53 4 317 3 coaA Pantothenate kinase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q57AH1 8.55e-114 335 53 5 311 3 coaA Pantothenate kinase Brucella abortus biovar 1 (strain 9-941)
Q2YQY6 8.55e-114 335 53 5 311 3 coaA Pantothenate kinase Brucella abortus (strain 2308)
B2S986 8.55e-114 335 53 5 311 3 coaA Pantothenate kinase Brucella abortus (strain S19)
P63809 1.65e-113 334 53 5 311 3 coaA Pantothenate kinase Brucella suis biovar 1 (strain 1330)
B0CJI8 1.65e-113 334 53 5 311 3 coaA Pantothenate kinase Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VT45 1.65e-113 334 53 5 311 3 coaA Pantothenate kinase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P63808 1.65e-113 334 53 5 311 3 coaA Pantothenate kinase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFX5 1.65e-113 334 53 5 311 3 coaA Pantothenate kinase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M9S1 1.65e-113 334 53 5 311 3 coaA Pantothenate kinase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
P9WPA7 2.47e-113 333 53 3 311 1 coaA Pantothenate kinase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPA6 2.47e-113 333 53 3 311 3 coaA Pantothenate kinase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U1D9 2.47e-113 333 53 3 311 3 coaA Pantothenate kinase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AM86 2.47e-113 333 53 3 311 3 coaA Pantothenate kinase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KHN2 2.47e-113 333 53 3 311 3 coaA Pantothenate kinase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P63811 2.47e-113 333 53 3 311 3 coaA Pantothenate kinase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A7IHN7 2.87e-113 333 50 1 317 3 coaA Pantothenate kinase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q92TB5 5.21e-113 333 53 5 311 3 coaA Pantothenate kinase Rhizobium meliloti (strain 1021)
A6UEK1 7.55e-113 332 53 5 311 3 coaA Pantothenate kinase Sinorhizobium medicae (strain WSM419)
A6WX50 2.69e-112 331 52 3 309 3 coaA Pantothenate kinase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A1TE33 2.75e-112 330 52 3 311 3 coaA Pantothenate kinase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
B0RD37 1.73e-111 328 51 1 308 3 coaA Pantothenate kinase Clavibacter sepedonicus
Q9X795 1.74e-111 328 52 3 311 3 coaA Pantothenate kinase Mycobacterium leprae (strain TN)
B8ZSH3 1.74e-111 328 52 3 311 3 coaA Pantothenate kinase Mycobacterium leprae (strain Br4923)
A5CU73 1.95e-111 328 51 1 309 3 coaA Pantothenate kinase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q98CS9 2.08e-111 328 51 2 311 3 coaA Pantothenate kinase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A0PKS1 8.94e-111 327 52 3 311 3 coaA Pantothenate kinase Mycobacterium ulcerans (strain Agy99)
B2HT62 8.94e-111 327 52 3 311 3 coaA Pantothenate kinase Mycobacterium marinum (strain ATCC BAA-535 / M)
A0R2V9 1.31e-110 326 51 3 318 3 coaA Pantothenate kinase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B9JG63 2.67e-110 326 52 3 318 3 coaA Pantothenate kinase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q2KE63 3.28e-110 326 52 5 318 3 coaA Pantothenate kinase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8UJ92 2.62e-109 323 52 5 318 3 coaA Pantothenate kinase Agrobacterium fabrum (strain C58 / ATCC 33970)
C3MBB9 4.44e-109 323 51 5 313 3 coaA Pantothenate kinase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A1UU59 3.34e-107 317 50 5 312 3 coaA Pantothenate kinase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q6A6T7 1.12e-106 317 50 2 313 3 coaA Pantothenate kinase Cutibacterium acnes (strain DSM 16379 / KPA171202)
A1R8P8 6.58e-106 315 49 0 307 3 coaA Pantothenate kinase Paenarthrobacter aurescens (strain TC1)
Q6AD31 2.95e-104 310 51 1 309 3 coaA Pantothenate kinase Leifsonia xyli subsp. xyli (strain CTCB07)
A7Z6C4 9.02e-100 299 48 2 307 3 coaA Pantothenate kinase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q8Y8I0 3.46e-98 294 46 4 306 3 coaA Pantothenate kinase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q721P1 3.46e-98 294 46 4 306 3 coaA Pantothenate kinase Listeria monocytogenes serotype 4b (strain F2365)
C1L1J5 3.46e-98 294 46 4 306 3 coaA Pantothenate kinase Listeria monocytogenes serotype 4b (strain CLIP80459)
A0AH37 6.52e-98 293 45 4 306 3 coaA Pantothenate kinase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B8DEL2 7.03e-98 293 46 4 306 3 coaA Pantothenate kinase Listeria monocytogenes serotype 4a (strain HCC23)
P54556 8.51e-97 291 48 2 307 3 coaA Pantothenate kinase Bacillus subtilis (strain 168)
Q92D94 9.39e-97 291 45 4 306 3 coaA Pantothenate kinase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q1WRY7 1.2e-95 288 48 2 305 3 coaA Pantothenate kinase Ligilactobacillus salivarius (strain UCC118)
Q839J7 9.03e-92 278 45 1 305 3 coaA Pantothenate kinase Enterococcus faecalis (strain ATCC 700802 / V583)
B2GEA0 1.09e-89 273 43 1 305 3 coaA Pantothenate kinase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q036Y4 7.49e-89 271 44 2 306 3 coaA Pantothenate kinase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3W953 7.49e-89 271 44 2 306 3 coaA Pantothenate kinase Lacticaseibacillus casei (strain BL23)
B2G996 1.57e-88 270 42 1 305 3 coaA Pantothenate kinase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLY5 1.57e-88 270 42 1 305 3 coaA Pantothenate kinase Limosilactobacillus reuteri (strain DSM 20016)
Q88Y75 4.56e-87 266 43 4 309 3 coaA Pantothenate kinase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B5E3L1 1.06e-83 257 43 3 308 3 coaA Pantothenate kinase Streptococcus pneumoniae serotype 19F (strain G54)
A4VVB5 1.48e-83 257 42 3 308 3 coaA Pantothenate kinase Streptococcus suis (strain 05ZYH33)
C1CS52 1.55e-83 257 43 3 308 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CDI6 1.55e-83 257 43 3 308 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain JJA)
B8ZNP1 1.55e-83 257 43 3 308 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
P63813 2.44e-83 256 41 3 302 3 coaA Pantothenate kinase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63812 2.44e-83 256 41 3 302 3 coaA Pantothenate kinase Streptococcus agalactiae serotype III (strain NEM316)
Q3K1D6 2.44e-83 256 41 3 302 3 coaA Pantothenate kinase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q03PP4 4.94e-83 256 41 1 305 3 coaA Pantothenate kinase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
C1CJS8 7.32e-83 255 42 3 308 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain P1031)
Q8DQC7 7.32e-83 255 42 3 308 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04L73 7.32e-83 255 42 3 308 3 coaA Pantothenate kinase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q97RH6 7.48e-83 255 42 3 308 3 coaA Pantothenate kinase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1IB08 2.03e-82 254 42 3 308 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain Hungary19A-6)
A4W1L8 2.72e-82 254 42 2 300 3 coaA Pantothenate kinase Streptococcus suis (strain 98HAH33)
C1C6H3 4.34e-82 253 42 3 308 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain 70585)
A8AX56 1.15e-81 252 42 3 308 3 coaA Pantothenate kinase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q8DU31 1.58e-81 252 42 2 301 3 coaA Pantothenate kinase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9CFM3 9.9e-81 250 43 4 302 3 coaA Pantothenate kinase Lactococcus lactis subsp. lactis (strain IL1403)
A2RK41 4.33e-80 248 43 4 302 3 coaA Pantothenate kinase Lactococcus lactis subsp. cremoris (strain MG1363)
Q02YD2 1.03e-79 247 43 4 302 3 coaA Pantothenate kinase Lactococcus lactis subsp. cremoris (strain SK11)
C0MG55 2e-79 246 41 4 303 3 coaA Pantothenate kinase Streptococcus equi subsp. zooepidemicus (strain H70)
B4U2S2 3.59e-79 246 41 4 303 3 coaA Pantothenate kinase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
A3CMP3 4.61e-79 246 41 3 308 3 coaA Pantothenate kinase Streptococcus sanguinis (strain SK36)
C0M9A7 8.75e-79 245 41 4 303 3 coaA Pantothenate kinase Streptococcus equi subsp. equi (strain 4047)
B5XLR5 2.01e-75 236 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M49 (strain NZ131)
Q03L30 2.85e-75 236 42 3 311 3 coaA Pantothenate kinase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q1JLI4 3.86e-75 236 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBK2 3.86e-75 236 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8P0V9 4.64e-75 235 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M18 (strain MGAS8232)
A2REA6 6.15e-75 235 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M5 (strain Manfredo)
P0DA41 7.97e-75 234 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DA40 7.97e-75 234 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q48TD0 8.15e-75 234 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J6D9 8.15e-75 234 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGM0 8.15e-75 234 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q5XBZ4 8.15e-75 234 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99ZH1 8.15e-75 234 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M1
Q5M4T8 1.12e-74 234 42 3 311 3 coaA Pantothenate kinase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M079 1.12e-74 234 42 3 311 3 coaA Pantothenate kinase Streptococcus thermophilus (strain CNRZ 1066)
Q38ZE2 1.32e-74 234 43 2 307 3 coaA Pantothenate kinase Latilactobacillus sakei subsp. sakei (strain 23K)
P11664 1.11e-09 61 29 4 154 4 yggC Uncharacterized protein YggC Escherichia coli (strain K12)
Q38VV6 7.48e-08 55 24 9 229 3 udk Uridine kinase Latilactobacillus sakei subsp. sakei (strain 23K)
Q081H5 3.19e-07 53 27 5 148 3 udk Uridine kinase Shewanella frigidimarina (strain NCIMB 400)
Q9FKS0 1.69e-06 52 23 10 230 1 UKL1 Uridine/cytidine kinase UKL1, chloroplastic Arabidopsis thaliana
Q66I71 6.63e-06 50 22 12 234 2 uck1 Uridine-cytidine kinase 1 Danio rerio
P26302 8.32e-06 50 28 6 174 2 None Phosphoribulokinase, chloroplastic Triticum aestivum
Q8VYB2 1.31e-05 50 21 9 240 2 UKL3 Uridine kinase-like protein 3 Arabidopsis thaliana
A6TBG6 1.66e-05 48 27 4 155 3 udk Uridine kinase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XPC8 1.66e-05 48 27 4 155 3 udk Uridine kinase Klebsiella pneumoniae (strain 342)
Q5SKR5 3.02e-05 47 30 6 148 1 udk Uridine kinase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72L53 3.02e-05 47 30 6 148 3 udk Uridine kinase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
P09559 3.36e-05 48 27 6 173 1 None Phosphoribulokinase, chloroplastic Spinacia oleracea
P37101 5.29e-05 47 28 8 169 2 prk Phosphoribulokinase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9LTY6 6.82e-05 47 27 7 162 2 UKL5 Uridine kinase-like protein 5 Arabidopsis thaliana
P27774 0.000112 47 27 7 185 2 None Phosphoribulokinase, chloroplastic Mesembryanthemum crystallinum
P19824 0.000131 47 27 8 176 1 PRKA Phosphoribulokinase, chloroplastic Chlamydomonas reinhardtii
B1JPY6 0.000153 45 27 4 151 3 udk Uridine kinase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66C70 0.000153 45 27 4 151 3 udk Uridine kinase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TKM7 0.000153 45 27 4 151 3 udk Uridine kinase Yersinia pestis (strain Pestoides F)
Q1CGU6 0.000153 45 27 4 151 3 udk Uridine kinase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2M5 0.000153 45 27 4 151 3 udk Uridine kinase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZFZ9 0.000153 45 27 4 151 3 udk Uridine kinase Yersinia pestis
B2JZK5 0.000153 45 27 4 151 3 udk Uridine kinase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C9T6 0.000153 45 27 4 151 3 udk Uridine kinase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FJJ4 0.000153 45 27 4 151 3 udk Uridine kinase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6GPD9 0.000153 46 21 10 233 2 uck1-b Uridine-cytidine kinase 1-B Xenopus laevis
C0ZAS6 0.000164 45 24 5 162 3 udk Uridine kinase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A1JTX4 0.000184 45 26 4 151 3 udk Uridine kinase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P25697 0.000248 45 28 7 176 1 At1g32060 Phosphoribulokinase, chloroplastic Arabidopsis thaliana
Q9HA47 0.000313 45 22 10 234 1 UCK1 Uridine-cytidine kinase 1 Homo sapiens
P52623 0.000539 44 22 9 236 1 Uck1 Uridine-cytidine kinase 1 Mus musculus
B2G882 0.000656 43 25 6 150 3 udk Uridine kinase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VKU8 0.000656 43 25 6 150 3 udk Uridine kinase Limosilactobacillus reuteri (strain DSM 20016)
A8H3V4 0.00082 43 25 4 153 3 udk Uridine kinase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_19690
Feature type CDS
Gene coaA
Product type I pantothenate kinase
Location 2564 - 3508 (strand: -1)
Length 945 (nucleotides) / 314 (amino acids)

Contig

Accession ZDB_250
Length 4582 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2448
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00485 Phosphoribulokinase / Uridine kinase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1072 Coenzyme transport and metabolism (H) H Panthothenate kinase

Kegg Ortholog Annotation(s)

Protein Sequence

MYKEKSLSPYLHFSRSQWATLRNSVPMTLSEQEIDDLRGIHDEISIDEVIAIYLPLSRLLNFYISSNLRRQAVLEQFLGRNEAKVPYVIGIAGSVSVGKSTTARLLQALLSRWPEHRKVDLITTDGFLHPNSVLNERGIMKKKGFPESYDMHNLVRFVSEVKSGTPRVLAPVYSHLTYDIIPDKQLVVEQPDIVILEGLNVLQSGMDYPEAMHHVFVSDFVDFSIYVDAPEELLKSWYIGRFLKFRQGAFSDPNSYFHHYAQLEESEAVSIASTIWDEINGLNLHENILPTRERASLVMTKGTNHMVTNVKLRK

Flanking regions ( +/- flanking 50bp)

CGGGTATTAATGACCTGTCCAACCTGCGTAATAAAGGCAGCTGTTGGTTTATGTATAAAGAAAAATCGCTCTCTCCTTATCTCCATTTCAGCCGCAGTCAGTGGGCGACCCTGCGTAACTCCGTTCCGATGACGTTGTCTGAGCAGGAAATTGACGATCTGCGCGGTATCCACGATGAAATCTCGATTGATGAAGTTATCGCGATTTATCTGCCACTGTCCCGTCTGCTGAACTTCTATATCAGCTCAAACCTGCGCCGTCAGGCCGTACTGGAGCAGTTCCTCGGCAGAAATGAAGCGAAAGTCCCTTATGTGATTGGTATTGCCGGCAGTGTGTCAGTCGGAAAAAGTACCACCGCCCGGTTATTGCAGGCGCTACTGAGCCGCTGGCCGGAACATCGCAAAGTGGATTTGATTACCACTGATGGTTTTCTTCATCCCAATTCTGTGCTGAATGAACGCGGTATTATGAAGAAGAAAGGATTCCCTGAATCCTATGACATGCATAATCTGGTGCGTTTCGTTTCTGAAGTGAAATCCGGTACCCCGCGGGTTCTGGCGCCGGTTTATTCACATCTGACCTATGACATTATCCCGGATAAACAGTTAGTGGTTGAGCAGCCGGATATCGTGATCCTGGAAGGCCTGAATGTGCTGCAGAGCGGGATGGATTATCCGGAAGCCATGCACCATGTGTTCGTGTCCGATTTTGTGGATTTCTCTATTTATGTGGATGCGCCGGAAGAATTACTGAAGAGCTGGTATATCGGGCGGTTCCTGAAATTCCGTCAGGGCGCATTCAGTGATCCTAATTCCTATTTCCATCACTATGCGCAACTTGAGGAAAGTGAGGCCGTCAGCATTGCCTCAACAATCTGGGATGAGATTAACGGCCTGAATCTGCATGAAAATATTCTGCCGACCAGAGAGCGGGCCAGCCTGGTGATGACCAAAGGCACCAATCATATGGTGACCAATGTGAAACTGCGGAAATAATCAGTTTTTCTGTTAAAAATAAACCGGATCAGGCCGGTTTATTTTTTGAA