Homologs in group_2448

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20350 FBDBKF_20350 75.8 Morganella morganii S1 coaA type I pantothenate kinase
EHELCC_19690 EHELCC_19690 75.8 Morganella morganii S2 coaA type I pantothenate kinase
NLDBIP_19665 NLDBIP_19665 75.8 Morganella morganii S4 coaA type I pantothenate kinase
LHKJJB_19635 LHKJJB_19635 75.8 Morganella morganii S3 coaA type I pantothenate kinase
HKOGLL_19545 HKOGLL_19545 75.8 Morganella morganii S5 coaA type I pantothenate kinase
F4V73_RS18875 F4V73_RS18875 75.2 Morganella psychrotolerans coaA type I pantothenate kinase

Distribution of the homologs in the orthogroup group_2448

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2448

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MYE7 0.0 530 79 1 316 3 coaA Pantothenate kinase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8AKV0 0.0 513 76 0 315 3 coaA Pantothenate kinase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q9L9K3 0.0 513 76 1 316 3 coaA Pantothenate kinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z318 0.0 513 76 1 316 3 coaA Pantothenate kinase Salmonella typhi
B4TQI6 0.0 513 76 1 316 3 coaA Pantothenate kinase Salmonella schwarzengrund (strain CVM19633)
B5BJP4 0.0 513 76 1 316 3 coaA Pantothenate kinase Salmonella paratyphi A (strain AKU_12601)
C0Q2Q8 0.0 513 76 1 316 3 coaA Pantothenate kinase Salmonella paratyphi C (strain RKS4594)
A9N0I2 0.0 513 76 1 316 3 coaA Pantothenate kinase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK80 0.0 513 76 1 316 3 coaA Pantothenate kinase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0Y0 0.0 513 76 1 316 3 coaA Pantothenate kinase Salmonella newport (strain SL254)
B4TCR5 0.0 513 76 1 316 3 coaA Pantothenate kinase Salmonella heidelberg (strain SL476)
B5QXR5 0.0 513 76 1 316 3 coaA Pantothenate kinase Salmonella enteritidis PT4 (strain P125109)
B5FPY5 0.0 513 76 1 316 3 coaA Pantothenate kinase Salmonella dublin (strain CT_02021853)
Q57H79 0.0 513 76 1 316 3 coaA Pantothenate kinase Salmonella choleraesuis (strain SC-B67)
B5F0V8 0.0 513 76 1 316 3 coaA Pantothenate kinase Salmonella agona (strain SL483)
C6DHQ6 0.0 513 76 1 316 3 coaA Pantothenate kinase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5XYG3 0.0 512 76 1 316 1 coaA Pantothenate kinase Klebsiella pneumoniae (strain 342)
A1JIH1 0.0 511 76 0 311 3 coaA Pantothenate kinase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6DAN8 0.0 511 76 0 314 3 coaA Pantothenate kinase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6TGN1 0.0 511 76 1 316 3 coaA Pantothenate kinase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5RFK9 0.0 510 76 1 316 3 coaA Pantothenate kinase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B1JJI8 0.0 510 75 1 316 3 coaA Pantothenate kinase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FR1 0.0 510 75 1 316 3 coaA Pantothenate kinase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TR20 0.0 510 75 1 316 3 coaA Pantothenate kinase Yersinia pestis (strain Pestoides F)
Q1CN90 0.0 510 75 1 316 3 coaA Pantothenate kinase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R361 0.0 510 75 1 316 3 coaA Pantothenate kinase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAN6 0.0 510 75 1 316 3 coaA Pantothenate kinase Yersinia pestis
B2K103 0.0 510 75 1 316 3 coaA Pantothenate kinase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2D3 0.0 510 75 1 316 3 coaA Pantothenate kinase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNJ3 0.0 510 75 1 316 3 coaA Pantothenate kinase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A7MQP3 0.0 508 76 1 316 3 coaA Pantothenate kinase Cronobacter sakazakii (strain ATCC BAA-894)
Q3YV06 0.0 506 76 1 316 3 coaA Pantothenate kinase Shigella sonnei (strain Ss046)
B7LUM3 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R5X9 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli (strain UTI89 / UPEC)
P0A6I3 0.0 506 76 1 316 1 coaA Pantothenate kinase Escherichia coli (strain K12)
P0A6I4 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA86 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AIF2 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli O1:K1 / APEC
A8A778 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli O9:H4 (strain HS)
B1XBY1 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli (strain K12 / DH10B)
C5A0R9 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M726 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli O8 (strain IAI1)
B7MR65 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli O81 (strain ED1a)
B7NR61 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0A6I5 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli O157:H7
B7LA72 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli (strain 55989 / EAEC)
B7MIW5 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UNV0 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUJ0 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli O139:H28 (strain E24377A / ETEC)
B1LNT0 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli (strain SMS-3-5 / SECEC)
B7NFR9 0.0 506 76 1 316 3 coaA Pantothenate kinase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A8G8D9 0.0 506 75 0 311 3 coaA Pantothenate kinase Serratia proteamaculans (strain 568)
Q83PC5 0.0 505 76 1 316 3 coaA Pantothenate kinase Shigella flexneri
Q32AF0 0.0 504 75 1 316 3 coaA Pantothenate kinase Shigella dysenteriae serotype 1 (strain Sd197)
Q31U19 1.24e-180 504 75 1 316 3 coaA Pantothenate kinase Shigella boydii serotype 4 (strain Sb227)
B2TWG4 1.24e-180 504 75 1 316 3 coaA Pantothenate kinase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B2VG89 1.19e-179 501 76 0 309 3 coaA Pantothenate kinase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4W599 7.41e-179 499 74 1 316 3 coaA Pantothenate kinase Enterobacter sp. (strain 638)
Q2NWS4 1.72e-178 498 75 0 307 3 coaA Pantothenate kinase Sodalis glossinidius (strain morsitans)
C4K6Z7 1.33e-168 473 70 1 316 3 coaA Pantothenate kinase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B3GYJ4 5.64e-158 446 66 0 307 3 coaA Pantothenate kinase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BRA6 7.5e-158 446 66 0 307 3 coaA Pantothenate kinase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N2G1 7.5e-158 446 66 0 307 3 coaA Pantothenate kinase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VPK9 8.55e-155 438 64 0 307 3 coaA Pantothenate kinase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q65QG5 1.66e-148 422 64 2 311 3 coaA Pantothenate kinase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P44793 2.63e-146 417 65 1 307 3 coaA Pantothenate kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57967 3.3e-145 414 64 1 307 3 coaA Pantothenate kinase Pasteurella multocida (strain Pm70)
Q9KV38 1.96e-144 412 61 1 311 3 coaA Pantothenate kinase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A1T0P0 3.85e-143 409 61 0 305 3 coaA Pantothenate kinase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A6VKH8 1.42e-142 407 61 1 313 3 coaA Pantothenate kinase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q8DD30 2.04e-141 404 59 1 307 3 coaA Pantothenate kinase Vibrio vulnificus (strain CMCP6)
Q7MGQ9 8.19e-141 402 59 1 307 3 coaA Pantothenate kinase Vibrio vulnificus (strain YJ016)
B0UV22 1.26e-140 402 62 1 307 3 coaA Pantothenate kinase Histophilus somni (strain 2336)
Q0I1U8 1.69e-140 402 62 1 307 3 coaA Pantothenate kinase Histophilus somni (strain 129Pt)
A3Q967 2.63e-140 402 63 0 305 3 coaA Pantothenate kinase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0TM27 3.31e-140 401 63 0 305 3 coaA Pantothenate kinase Shewanella halifaxensis (strain HAW-EB4)
A8GYW1 3.56e-139 399 63 0 305 3 coaA Pantothenate kinase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B8CNB7 1.31e-138 397 63 0 305 3 coaA Pantothenate kinase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q089R9 1.02e-136 392 60 0 305 3 coaA Pantothenate kinase Shewanella frigidimarina (strain NCIMB 400)
B1KMZ8 6.1e-136 390 62 0 308 3 coaA Pantothenate kinase Shewanella woodyi (strain ATCC 51908 / MS32)
A1S203 1.15e-135 390 59 0 315 3 coaA Pantothenate kinase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8G1G2 1.54e-135 389 62 0 305 3 coaA Pantothenate kinase Shewanella sediminis (strain HAW-EB3)
A6WHR3 5.34e-134 385 59 0 305 3 coaA Pantothenate kinase Shewanella baltica (strain OS185)
A3DA75 5.34e-134 385 59 0 305 3 coaA Pantothenate kinase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBM0 5.34e-134 385 59 0 305 3 coaA Pantothenate kinase Shewanella baltica (strain OS223)
A9KW87 6.29e-134 385 59 0 305 3 coaA Pantothenate kinase Shewanella baltica (strain OS195)
A0KRK9 1.19e-133 385 59 0 305 3 coaA Pantothenate kinase Shewanella sp. (strain ANA-3)
A1RE99 1.31e-133 385 59 0 305 3 coaA Pantothenate kinase Shewanella sp. (strain W3-18-1)
A4YBZ8 1.31e-133 385 59 0 305 3 coaA Pantothenate kinase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EK83 2.52e-133 384 59 0 305 3 coaA Pantothenate kinase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
C0Z7P4 4.95e-133 383 57 1 311 3 coaA Pantothenate kinase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q0HNV3 1.3e-132 382 59 0 305 3 coaA Pantothenate kinase Shewanella sp. (strain MR-4)
Q0I0C1 1.36e-132 382 59 0 305 3 coaA Pantothenate kinase Shewanella sp. (strain MR-7)
Q12SX3 4.35e-132 381 59 0 305 3 coaA Pantothenate kinase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A8HYS9 4.33e-127 368 56 3 311 3 coaA Pantothenate kinase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q1D9X8 2.38e-125 363 54 0 305 3 coaA Pantothenate kinase Myxococcus xanthus (strain DK1622)
A7HSG6 4.69e-125 363 55 0 307 3 coaA Pantothenate kinase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A5E8E3 7.11e-124 360 55 2 316 3 coaA Pantothenate kinase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A4YJV7 1.65e-123 359 55 2 316 3 coaA Pantothenate kinase Bradyrhizobium sp. (strain ORS 278)
Q3SWF3 2.37e-122 356 55 2 307 3 coaA Pantothenate kinase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q07UR1 3.43e-122 356 55 2 307 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain BisA53)
Q21CJ9 7.13e-122 355 55 2 307 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain BisB18)
B6JCG7 1.33e-121 354 56 2 307 3 coaA Pantothenate kinase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q0S4A2 6.48e-121 352 53 2 310 3 coaA Pantothenate kinase Rhodococcus jostii (strain RHA1)
C1AYH1 6.77e-121 352 53 2 310 3 coaA Pantothenate kinase Rhodococcus opacus (strain B4)
Q89WM2 1.11e-120 352 55 2 312 3 coaA Pantothenate kinase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q13E42 2.51e-120 351 55 2 307 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain BisB5)
B1MKN0 2.96e-120 350 54 2 309 3 coaA Pantothenate kinase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q2J338 3.23e-120 351 54 2 307 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain HaA2)
O86779 3.34e-120 351 52 1 310 3 coaA Pantothenate kinase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A4QCW5 4.36e-120 350 53 2 308 3 coaA Pantothenate kinase Corynebacterium glutamicum (strain R)
Q5YQ72 1.98e-119 348 52 2 309 3 coaA Pantothenate kinase Nocardia farcinica (strain IFM 10152)
Q8NRQ2 3.82e-119 348 53 2 308 3 coaA Pantothenate kinase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B3Q953 4.63e-119 348 53 2 307 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain TIE-1)
Q6ND01 4.63e-119 348 53 2 307 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q47LM9 5.86e-119 347 51 2 314 3 coaA Pantothenate kinase Thermobifida fusca (strain YX)
A1SF33 1.03e-118 347 53 1 311 3 coaA Pantothenate kinase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q4JU68 1.46e-118 346 53 1 307 3 coaA Pantothenate kinase Corynebacterium jeikeium (strain K411)
Q1QRW8 1.59e-118 347 54 2 307 3 coaA Pantothenate kinase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q82DL5 2.84e-118 346 51 1 310 3 coaA Pantothenate kinase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A4T9A9 4.13e-118 345 54 2 311 3 coaA Pantothenate kinase Mycolicibacterium gilvum (strain PYR-GCK)
A0PKS1 3.15e-117 343 53 2 311 3 coaA Pantothenate kinase Mycobacterium ulcerans (strain Agy99)
B2HT62 3.15e-117 343 53 2 311 3 coaA Pantothenate kinase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q8FQR2 3.31e-117 343 52 2 313 3 coaA Pantothenate kinase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
C1A2X7 4.21e-117 342 52 2 310 3 coaA Pantothenate kinase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q1B4E6 5.2e-117 342 53 2 311 3 coaA Pantothenate kinase Mycobacterium sp. (strain MCS)
A1UKP2 5.2e-117 342 53 2 311 3 coaA Pantothenate kinase Mycobacterium sp. (strain KMS)
A3Q4Q8 5.2e-117 342 53 2 311 3 coaA Pantothenate kinase Mycobacterium sp. (strain JLS)
P9WPA7 6.98e-117 342 52 2 311 1 coaA Pantothenate kinase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPA6 6.98e-117 342 52 2 311 3 coaA Pantothenate kinase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U1D9 6.98e-117 342 52 2 311 3 coaA Pantothenate kinase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AM86 6.98e-117 342 52 2 311 3 coaA Pantothenate kinase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KHN2 6.98e-117 342 52 2 311 3 coaA Pantothenate kinase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P63811 6.98e-117 342 52 2 311 3 coaA Pantothenate kinase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A9FRP1 7.83e-117 342 52 1 308 3 coaA Pantothenate kinase Sorangium cellulosum (strain So ce56)
A9KD67 8.74e-117 342 52 0 307 3 coaA Pantothenate kinase Coxiella burnetii (strain Dugway 5J108-111)
Q83EV9 9.23e-117 342 52 0 307 1 coaA Pantothenate kinase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q73WG0 1.08e-116 342 53 2 311 3 coaA Pantothenate kinase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A1TE33 1.48e-116 341 53 2 311 3 coaA Pantothenate kinase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q9X795 1.99e-116 341 53 2 311 3 coaA Pantothenate kinase Mycobacterium leprae (strain TN)
B8ZSH3 1.99e-116 341 53 2 311 3 coaA Pantothenate kinase Mycobacterium leprae (strain Br4923)
A9NAJ3 3.38e-116 340 52 0 307 3 coaA Pantothenate kinase Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J2J7 3.38e-116 340 52 0 307 3 coaA Pantothenate kinase Coxiella burnetii (strain CbuG_Q212)
B6J596 3.38e-116 340 52 0 307 3 coaA Pantothenate kinase Coxiella burnetii (strain CbuK_Q154)
A7IHN7 1.08e-115 339 52 3 314 3 coaA Pantothenate kinase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A0R2V9 1.91e-115 338 52 2 311 3 coaA Pantothenate kinase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
C3PFC1 2.78e-115 338 52 1 308 3 coaA Pantothenate kinase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q6NI48 7.77e-113 332 51 1 312 3 coaA Pantothenate kinase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q9K8X7 1.31e-112 331 52 1 305 3 coaA Pantothenate kinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B3PWH7 2.66e-112 331 52 5 312 3 coaA Pantothenate kinase Rhizobium etli (strain CIAT 652)
B9JXX1 4.95e-112 330 53 4 311 3 coaA Pantothenate kinase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q11CK5 1.02e-111 329 52 6 316 3 coaA Pantothenate kinase Chelativorans sp. (strain BNC1)
Q5WEY6 3.3e-111 328 53 1 305 3 coaA Pantothenate kinase Shouchella clausii (strain KSM-K16)
B5ZV89 3.6e-111 328 52 5 312 3 coaA Pantothenate kinase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q57AH1 8.29e-111 327 52 5 311 3 coaA Pantothenate kinase Brucella abortus biovar 1 (strain 9-941)
Q2YQY6 8.29e-111 327 52 5 311 3 coaA Pantothenate kinase Brucella abortus (strain 2308)
B2S986 8.29e-111 327 52 5 311 3 coaA Pantothenate kinase Brucella abortus (strain S19)
Q92TB5 1.21e-110 327 52 5 311 3 coaA Pantothenate kinase Rhizobium meliloti (strain 1021)
B9JG63 1.47e-110 327 53 5 312 3 coaA Pantothenate kinase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
P63809 1.74e-110 326 52 5 311 3 coaA Pantothenate kinase Brucella suis biovar 1 (strain 1330)
B0CJI8 1.74e-110 326 52 5 311 3 coaA Pantothenate kinase Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VT45 1.74e-110 326 52 5 311 3 coaA Pantothenate kinase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P63808 1.74e-110 326 52 5 311 3 coaA Pantothenate kinase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFX5 1.74e-110 326 52 5 311 3 coaA Pantothenate kinase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M9S1 1.74e-110 326 52 5 311 3 coaA Pantothenate kinase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q1MNG0 4.42e-110 325 52 5 312 3 coaA Pantothenate kinase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A6UEK1 4.77e-110 325 51 5 311 3 coaA Pantothenate kinase Sinorhizobium medicae (strain WSM419)
A6WX50 1.82e-109 323 51 3 309 3 coaA Pantothenate kinase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
C3MBB9 1.51e-108 322 51 5 312 3 coaA Pantothenate kinase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A1UU59 2.85e-108 320 52 5 312 3 coaA Pantothenate kinase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q6AD31 2.9e-108 320 50 1 308 3 coaA Pantothenate kinase Leifsonia xyli subsp. xyli (strain CTCB07)
Q98CS9 3.41e-108 320 51 4 312 3 coaA Pantothenate kinase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A5CU73 1.33e-107 319 50 1 307 3 coaA Pantothenate kinase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
B0RD37 1.87e-107 318 50 1 307 3 coaA Pantothenate kinase Clavibacter sepedonicus
A1R8P8 3.75e-106 315 47 0 308 3 coaA Pantothenate kinase Paenarthrobacter aurescens (strain TC1)
Q2KE63 1.89e-105 314 52 5 312 3 coaA Pantothenate kinase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P54556 3.69e-105 313 50 4 319 3 coaA Pantothenate kinase Bacillus subtilis (strain 168)
Q8UJ92 4.55e-105 312 51 5 312 3 coaA Pantothenate kinase Agrobacterium fabrum (strain C58 / ATCC 33970)
A7Z6C4 1.44e-104 311 49 4 319 3 coaA Pantothenate kinase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q6A6T7 1.63e-102 306 48 1 309 3 coaA Pantothenate kinase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q1WRY7 3.54e-100 299 49 3 307 3 coaA Pantothenate kinase Ligilactobacillus salivarius (strain UCC118)
B2GEA0 3.81e-99 297 48 1 305 3 coaA Pantothenate kinase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B2G996 1.86e-97 293 48 2 307 3 coaA Pantothenate kinase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLY5 1.86e-97 293 48 2 307 3 coaA Pantothenate kinase Limosilactobacillus reuteri (strain DSM 20016)
Q839J7 3.14e-95 287 46 4 311 3 coaA Pantothenate kinase Enterococcus faecalis (strain ATCC 700802 / V583)
Q8Y8I0 7.92e-95 286 45 3 306 3 coaA Pantothenate kinase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q721P1 7.92e-95 286 45 3 306 3 coaA Pantothenate kinase Listeria monocytogenes serotype 4b (strain F2365)
C1L1J5 7.92e-95 286 45 3 306 3 coaA Pantothenate kinase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q036Y4 1.43e-94 285 46 2 306 3 coaA Pantothenate kinase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3W953 1.43e-94 285 46 2 306 3 coaA Pantothenate kinase Lacticaseibacillus casei (strain BL23)
B8DEL2 4.23e-94 284 45 3 306 3 coaA Pantothenate kinase Listeria monocytogenes serotype 4a (strain HCC23)
A0AH37 1.42e-93 283 44 4 306 3 coaA Pantothenate kinase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q92D94 2.03e-93 282 44 4 306 3 coaA Pantothenate kinase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q88Y75 1.63e-90 275 45 3 309 3 coaA Pantothenate kinase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q03PP4 2.7e-89 272 44 1 305 3 coaA Pantothenate kinase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
P63813 4.09e-89 271 44 5 320 3 coaA Pantothenate kinase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63812 4.09e-89 271 44 5 320 3 coaA Pantothenate kinase Streptococcus agalactiae serotype III (strain NEM316)
Q3K1D6 4.09e-89 271 44 5 320 3 coaA Pantothenate kinase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8DU31 4.34e-87 266 45 2 300 3 coaA Pantothenate kinase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B4U2S2 8.42e-87 265 45 4 302 3 coaA Pantothenate kinase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0MG55 9.49e-87 265 45 4 302 3 coaA Pantothenate kinase Streptococcus equi subsp. zooepidemicus (strain H70)
C0M9A7 1.69e-86 265 44 4 302 3 coaA Pantothenate kinase Streptococcus equi subsp. equi (strain 4047)
Q9CFM3 6.57e-85 260 45 4 304 3 coaA Pantothenate kinase Lactococcus lactis subsp. lactis (strain IL1403)
A4VVB5 1.38e-84 259 43 2 303 3 coaA Pantothenate kinase Streptococcus suis (strain 05ZYH33)
A8AX56 5.29e-84 258 43 3 311 3 coaA Pantothenate kinase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A4W1L8 2.4e-83 256 43 2 303 3 coaA Pantothenate kinase Streptococcus suis (strain 98HAH33)
A2RK41 2.73e-83 256 44 4 304 3 coaA Pantothenate kinase Lactococcus lactis subsp. cremoris (strain MG1363)
Q02YD2 7.57e-83 255 44 4 304 3 coaA Pantothenate kinase Lactococcus lactis subsp. cremoris (strain SK11)
B5E3L1 2.24e-82 254 43 3 311 3 coaA Pantothenate kinase Streptococcus pneumoniae serotype 19F (strain G54)
C1CS52 3.58e-82 253 43 3 311 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CDI6 3.58e-82 253 43 3 311 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain JJA)
B8ZNP1 3.58e-82 253 43 3 311 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1CJS8 7.49e-82 253 42 3 311 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain P1031)
Q8DQC7 7.49e-82 253 42 3 311 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04L73 7.49e-82 253 42 3 311 3 coaA Pantothenate kinase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B1IB08 1.36e-81 252 42 3 311 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain Hungary19A-6)
Q97RH6 1.38e-81 252 42 3 311 3 coaA Pantothenate kinase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C1C6H3 4.12e-81 251 42 3 311 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain 70585)
A3CMP3 4.43e-80 248 41 3 311 3 coaA Pantothenate kinase Streptococcus sanguinis (strain SK36)
B5XLR5 2.54e-79 246 46 4 302 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M49 (strain NZ131)
Q1JLI4 3.03e-79 246 46 4 302 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBK2 3.03e-79 246 46 4 302 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8P0V9 4.88e-79 246 46 4 302 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M18 (strain MGAS8232)
A2REA6 5.93e-79 245 46 4 302 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q48TD0 7.77e-79 245 46 4 302 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J6D9 7.77e-79 245 46 4 302 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGM0 7.77e-79 245 46 4 302 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q5XBZ4 7.77e-79 245 46 4 302 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99ZH1 7.77e-79 245 46 4 302 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M1
P0DA41 8.21e-79 245 46 4 302 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DA40 8.21e-79 245 46 4 302 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q38ZE2 5.99e-77 240 44 2 307 3 coaA Pantothenate kinase Latilactobacillus sakei subsp. sakei (strain 23K)
Q03L30 1.84e-76 239 44 3 302 3 coaA Pantothenate kinase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M4T8 6.53e-76 238 44 3 302 3 coaA Pantothenate kinase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M079 6.53e-76 238 44 3 302 3 coaA Pantothenate kinase Streptococcus thermophilus (strain CNRZ 1066)
Q66I71 1.12e-06 52 28 8 153 2 uck1 Uridine-cytidine kinase 1 Danio rerio
P11664 1.52e-06 52 25 3 164 4 yggC Uncharacterized protein YggC Escherichia coli (strain K12)
Q9FKS0 1.66e-06 52 24 10 227 1 UKL1 Uridine/cytidine kinase UKL1, chloroplastic Arabidopsis thaliana
Q9PQF9 2.6e-06 50 26 6 157 3 udk Uridine kinase Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AIX1 2.6e-06 50 26 6 157 3 udk Uridine kinase Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Q9LK34 2.91e-06 52 24 10 225 1 UKL2 Uridine/cytidine kinase UKL1, chloroplastic Arabidopsis thaliana
P26302 2.98e-06 52 28 7 193 2 None Phosphoribulokinase, chloroplastic Triticum aestivum
Q38VV6 4.34e-06 50 24 6 228 3 udk Uridine kinase Latilactobacillus sakei subsp. sakei (strain 23K)
Q5SKR5 5.54e-06 50 25 11 229 1 udk Uridine kinase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72L53 5.54e-06 50 25 11 229 3 udk Uridine kinase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q8VYB2 5.69e-06 51 25 12 224 2 UKL3 Uridine kinase-like protein 3 Arabidopsis thaliana
Q9LTY6 8.21e-06 50 25 8 174 2 UKL5 Uridine kinase-like protein 5 Arabidopsis thaliana
C0ZAS6 1.04e-05 49 25 5 146 3 udk Uridine kinase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
P27774 1.48e-05 49 28 5 166 2 None Phosphoribulokinase, chloroplastic Mesembryanthemum crystallinum
Q9HA47 1.53e-05 49 25 6 151 1 UCK1 Uridine-cytidine kinase 1 Homo sapiens
P09559 2.3e-05 49 27 6 173 1 None Phosphoribulokinase, chloroplastic Spinacia oleracea
A1S796 3.7e-05 47 25 6 185 3 udk Uridine kinase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
P19824 4.22e-05 48 27 6 173 1 PRKA Phosphoribulokinase, chloroplastic Chlamydomonas reinhardtii
P52623 0.000115 46 24 6 151 1 Uck1 Uridine-cytidine kinase 1 Mus musculus
P37101 0.0002 46 25 5 165 2 prk Phosphoribulokinase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A8H3V4 0.000211 45 28 3 122 3 udk Uridine kinase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q6PA79 0.000225 45 25 6 151 2 uck1-a Uridine-cytidine kinase 1-A Xenopus laevis
Q6GPD9 0.000385 45 22 9 230 2 uck1-b Uridine-cytidine kinase 1-B Xenopus laevis
A1JTX4 0.000463 44 27 5 153 3 udk Uridine kinase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7SYM0 0.000466 44 22 10 230 2 uck2a Uridine-cytidine kinase 2-A Danio rerio
B1JPY6 0.000481 44 28 5 152 3 udk Uridine kinase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66C70 0.000481 44 28 5 152 3 udk Uridine kinase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TKM7 0.000481 44 28 5 152 3 udk Uridine kinase Yersinia pestis (strain Pestoides F)
Q1CGU6 0.000481 44 28 5 152 3 udk Uridine kinase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2M5 0.000481 44 28 5 152 3 udk Uridine kinase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZFZ9 0.000481 44 28 5 152 3 udk Uridine kinase Yersinia pestis
B2JZK5 0.000481 44 28 5 152 3 udk Uridine kinase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C9T6 0.000481 44 28 5 152 3 udk Uridine kinase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FJJ4 0.000481 44 28 5 152 3 udk Uridine kinase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q0P5A4 0.000838 43 24 6 151 2 UCK1 Uridine-cytidine kinase 1 Bos taurus
Q9KDD8 0.001 43 22 10 227 3 udk Uridine kinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16100
Feature type CDS
Gene coaA
Product type I pantothenate kinase
Location 3577966 - 3578913 (strand: -1)
Length 948 (nucleotides) / 315 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2448
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00485 Phosphoribulokinase / Uridine kinase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1072 Coenzyme transport and metabolism (H) H Panthothenate kinase

Kegg Ortholog Annotation(s)

Protein Sequence

MNNKERFTTPYLEFDRKQWATLRNSVPLTLTETEIADLKGINEEISIDDVIEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNNAKIPYIIGIAGSVAVGKSTTARLLQALLTRWPEHRKVDLITTDGFLLPNAELKKRGIMKKKGFPESYDMHSLVSFVSDIKSGKKQVTAPVYSHLVYDIIPDKKQVIEQPDILILEGLNVLQSNQDYPHDPHNVFVSDYVDFSIYVDADEALLKHWYISRFLKFREGAFTDPESYFNNYSKLSREESIEIASSIWQEINGLNLKQNILPTRERASLIMTKGDNHSVKSVRLRK

Flanking regions ( +/- flanking 50bp)

GTGTTTTAAACAGCCTGTCCAACCTGCGAATACTAGGCAGATGTTGGCTTATGAATAACAAAGAACGCTTTACAACCCCTTATTTAGAATTTGATAGAAAGCAGTGGGCTACGTTAAGGAATTCGGTTCCCTTAACATTAACAGAAACAGAAATTGCCGACCTTAAAGGCATTAATGAAGAAATCTCAATTGATGATGTCATTGAAATTTATCTTCCATTATCAAGGTTGTTAAATTTCTATATCAGTTCAAATTTACGTCGTCAGGCTGTCTTAGAACAGTTTCTAGGCACAAATAACGCCAAAATTCCTTATATCATTGGTATAGCGGGTAGCGTAGCGGTGGGTAAAAGTACGACTGCCCGTTTACTTCAAGCTTTGCTAACTCGTTGGCCTGAACATCGGAAAGTGGATTTGATTACCACTGATGGATTTTTATTACCTAATGCGGAATTAAAAAAACGCGGAATAATGAAGAAAAAAGGGTTTCCTGAATCCTATGATATGCATAGTCTTGTCTCTTTTGTCTCTGATATTAAATCGGGCAAAAAGCAAGTGACTGCACCTGTCTATTCTCATTTAGTGTATGACATTATTCCAGACAAAAAACAGGTCATTGAGCAACCCGATATTTTGATCCTTGAAGGACTCAATGTATTACAGAGTAATCAAGACTACCCTCATGATCCACACAATGTTTTTGTATCAGATTATGTCGACTTTTCCATTTATGTTGATGCAGATGAAGCATTATTGAAACACTGGTATATCAGCCGATTTTTAAAATTCCGTGAAGGGGCATTTACCGATCCCGAATCCTATTTCAATAATTATTCCAAACTGAGTCGCGAAGAATCTATTGAGATCGCGTCTTCCATTTGGCAAGAAATTAATGGCTTAAACCTAAAGCAAAATATTTTACCAACCCGTGAAAGAGCCAGTTTGATTATGACTAAGGGTGATAACCATTCGGTTAAAAGTGTTAGGTTACGTAAATAAATCTTACCTATTTAGAGAATAGATAAATTATCAATTCTCACCCTATAAAT