Homologs in group_2135

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15790 FBDBKF_15790 100.0 Morganella morganii S1 - Sulfurtransferase required for thiamine and 4-thiouridine biosynthesis
NLDBIP_19615 NLDBIP_19615 100.0 Morganella morganii S4 - Sulfurtransferase required for thiamine and 4-thiouridine biosynthesis
LHKJJB_19605 LHKJJB_19605 100.0 Morganella morganii S3 - Sulfurtransferase required for thiamine and 4-thiouridine biosynthesis
HKOGLL_19495 HKOGLL_19495 100.0 Morganella morganii S5 - Sulfurtransferase required for thiamine and 4-thiouridine biosynthesis
F4V73_RS16520 F4V73_RS16520 81.0 Morganella psychrotolerans thiI tRNA uracil 4-sulfurtransferase ThiI
PMI_RS00465 PMI_RS00465 75.9 Proteus mirabilis HI4320 thiI tRNA uracil 4-sulfurtransferase ThiI

Distribution of the homologs in the orthogroup group_2135

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2135

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EU34 2.71e-68 216 76 0 136 3 thiI tRNA sulfurtransferase Proteus mirabilis (strain HI4320)
A1JNR2 8.9e-65 207 73 0 137 3 thiI tRNA sulfurtransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JID5 1.92e-64 206 73 0 137 3 thiI tRNA sulfurtransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TPF8 1.92e-64 206 73 0 137 3 thiI tRNA sulfurtransferase Yersinia pestis (strain Pestoides F)
Q1CL83 1.92e-64 206 73 0 137 3 thiI tRNA sulfurtransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZR9 1.92e-64 206 73 0 137 3 thiI tRNA sulfurtransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZC49 1.92e-64 206 73 0 137 3 thiI tRNA sulfurtransferase Yersinia pestis
Q1C4J3 1.92e-64 206 73 0 137 3 thiI tRNA sulfurtransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLE0 1.92e-64 206 73 0 137 3 thiI tRNA sulfurtransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66DV0 2.14e-64 206 73 0 137 3 thiI tRNA sulfurtransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K6U1 2.14e-64 206 73 0 137 3 thiI tRNA sulfurtransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q7N0J9 4.2e-64 205 70 0 137 3 thiI tRNA sulfurtransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8Z8X1 1.04e-61 199 69 0 137 3 thiI tRNA sulfurtransferase Salmonella typhi
B4TMA5 1.07e-61 199 69 0 137 3 thiI tRNA sulfurtransferase Salmonella schwarzengrund (strain CVM19633)
B5BDA7 1.07e-61 199 69 0 137 3 thiI tRNA sulfurtransferase Salmonella paratyphi A (strain AKU_12601)
Q5PFQ4 1.07e-61 199 69 0 137 3 thiI tRNA sulfurtransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5EXG6 1.07e-61 199 69 0 137 3 thiI tRNA sulfurtransferase Salmonella agona (strain SL483)
A9MM39 1.72e-61 198 69 0 137 3 thiI tRNA sulfurtransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5Z3S9 2.22e-61 198 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE74 2.22e-61 198 70 0 137 1 thiI tRNA sulfurtransferase Escherichia coli O157:H7
A9MX06 3.51e-61 197 68 0 137 3 thiI tRNA sulfurtransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5Y0W8 3.55e-61 197 70 0 137 3 thiI tRNA sulfurtransferase Klebsiella pneumoniae (strain 342)
A8GAP5 6.12e-61 197 70 0 137 3 thiI tRNA sulfurtransferase Serratia proteamaculans (strain 568)
Q57SD9 9.9e-61 196 68 0 137 3 thiI tRNA sulfurtransferase Salmonella choleraesuis (strain SC-B67)
P55913 1.14e-60 196 68 0 137 3 thiI tRNA sulfurtransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C0Q7V0 1.14e-60 196 68 0 137 3 thiI tRNA sulfurtransferase Salmonella paratyphi C (strain RKS4594)
B4SWR7 1.16e-60 196 68 0 137 3 thiI tRNA sulfurtransferase Salmonella newport (strain SL254)
B4T8R6 1.16e-60 196 68 0 137 3 thiI tRNA sulfurtransferase Salmonella heidelberg (strain SL476)
C6DB40 1.64e-60 196 67 0 137 3 thiI tRNA sulfurtransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5QTH3 1.88e-60 196 68 0 137 3 thiI tRNA sulfurtransferase Salmonella enteritidis PT4 (strain P125109)
B5FKT0 1.88e-60 196 68 0 137 3 thiI tRNA sulfurtransferase Salmonella dublin (strain CT_02021853)
A8AK31 5.07e-60 194 69 0 137 3 thiI tRNA sulfurtransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5R6S6 7.69e-60 194 67 0 137 3 thiI tRNA sulfurtransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q6D841 1.73e-59 193 67 0 137 3 thiI tRNA sulfurtransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q87RT6 1.59e-58 191 67 0 137 3 thiI tRNA sulfurtransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C5BCI2 1.7e-58 191 69 0 137 3 thiI tRNA sulfurtransferase Edwardsiella ictaluri (strain 93-146)
B2VHS0 1.87e-58 191 65 0 137 3 thiI tRNA sulfurtransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6LU02 5.31e-57 187 64 0 137 3 thiI tRNA sulfurtransferase Photobacterium profundum (strain SS9)
Q8DFA8 6.85e-57 186 67 0 137 3 thiI tRNA sulfurtransferase Vibrio vulnificus (strain CMCP6)
Q7MN44 6.93e-57 186 67 0 137 3 thiI tRNA sulfurtransferase Vibrio vulnificus (strain YJ016)
A6T5F6 6.08e-56 184 70 0 137 3 thiI tRNA sulfurtransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MYC5 7.09e-55 181 64 0 137 3 thiI tRNA sulfurtransferase Vibrio campbellii (strain ATCC BAA-1116)
B7VJ96 3.04e-54 179 62 0 137 3 thiI tRNA sulfurtransferase Vibrio atlanticus (strain LGP32)
B6EIB2 2.98e-53 177 62 0 137 3 thiI tRNA sulfurtransferase Aliivibrio salmonicida (strain LFI1238)
A0KIY0 6.4e-53 176 62 0 137 3 thiI tRNA sulfurtransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B0TQ31 1.09e-52 176 59 0 137 3 thiI tRNA sulfurtransferase Shewanella halifaxensis (strain HAW-EB4)
A4SP64 3.14e-52 174 60 0 137 3 thiI tRNA sulfurtransferase Aeromonas salmonicida (strain A449)
Q32JI1 3.17e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Shigella dysenteriae serotype 1 (strain Sd197)
B7N8X6 4.41e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P77718 4.41e-52 174 70 0 137 1 thiI tRNA sulfurtransferase Escherichia coli (strain K12)
B1XF11 4.41e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli (strain K12 / DH10B)
C4ZTI0 4.41e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli (strain K12 / MC4100 / BW2952)
Q83SG1 4.9e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Shigella flexneri
Q0T7G6 4.9e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Shigella flexneri serotype 5b (strain 8401)
B1LJH3 5.5e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli (strain SMS-3-5 / SECEC)
B7NJ74 5.5e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7UJP6 5.5e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q1RFB7 5.68e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli (strain UTI89 / UPEC)
Q8FKB7 5.68e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1A892 5.68e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli O1:K1 / APEC
B7MQD8 5.68e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli O81 (strain ED1a)
B7MD81 5.68e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B1J026 5.74e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q3Z4Y6 5.8e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Shigella sonnei (strain Ss046)
A7ZX76 5.87e-52 174 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli O9:H4 (strain HS)
B6HZM6 6.73e-52 173 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli (strain SE11)
B7L657 6.73e-52 173 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli (strain 55989 / EAEC)
Q325H8 1.13e-51 173 70 0 137 3 thiI tRNA sulfurtransferase Shigella boydii serotype 4 (strain Sb227)
B7LMG4 1.16e-51 173 70 0 137 3 thiI tRNA sulfurtransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B8CQH4 2.26e-51 172 59 0 137 3 thiI tRNA sulfurtransferase Shewanella piezotolerans (strain WP3 / JCM 13877)
A7ZIH7 2.28e-51 172 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
P57849 2.34e-51 172 61 1 136 3 thiI tRNA sulfurtransferase Pasteurella multocida (strain Pm70)
B7M3R2 2.9e-51 172 70 0 137 3 thiI tRNA sulfurtransferase Escherichia coli O8 (strain IAI1)
Q65TP1 2.94e-51 172 60 0 135 3 thiI tRNA sulfurtransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q2NV91 5.3e-51 171 60 1 138 3 thiI tRNA sulfurtransferase Sodalis glossinidius (strain morsitans)
B2U4M7 7.94e-51 171 70 0 136 3 thiI tRNA sulfurtransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A9KTM0 1.18e-50 170 56 0 137 3 thiI tRNA sulfurtransferase Shewanella baltica (strain OS195)
A6WL09 1.18e-50 170 56 0 137 3 thiI tRNA sulfurtransferase Shewanella baltica (strain OS185)
A3D2B7 1.18e-50 170 56 0 137 3 thiI tRNA sulfurtransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EAU2 1.18e-50 170 56 0 137 3 thiI tRNA sulfurtransferase Shewanella baltica (strain OS223)
A1RLU8 1.31e-50 170 59 0 137 3 thiI tRNA sulfurtransferase Shewanella sp. (strain W3-18-1)
A4Y4X5 1.31e-50 170 59 0 137 3 thiI tRNA sulfurtransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8FYK5 9.99e-50 168 56 0 137 3 thiI tRNA sulfurtransferase Shewanella sediminis (strain HAW-EB3)
A8H6W6 1.81e-49 167 56 0 137 3 thiI tRNA sulfurtransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3QGN4 2.92e-49 167 60 0 137 3 thiI tRNA sulfurtransferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
C4LAC1 4.28e-49 166 59 0 136 3 thiI tRNA sulfurtransferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q8EGR4 1.34e-48 165 57 0 137 3 thiI tRNA sulfurtransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HSX1 1.4e-48 165 57 0 137 3 thiI tRNA sulfurtransferase Shewanella sp. (strain MR-7)
A0KZA4 1.41e-48 165 57 0 137 3 thiI tRNA sulfurtransferase Shewanella sp. (strain ANA-3)
A1S8C9 1.56e-48 165 56 0 137 3 thiI tRNA sulfurtransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0HGM0 2.4e-48 164 57 0 137 3 thiI tRNA sulfurtransferase Shewanella sp. (strain MR-4)
Q07ZD9 2.45e-48 164 57 0 137 3 thiI tRNA sulfurtransferase Shewanella frigidimarina (strain NCIMB 400)
Q0I3G4 4.06e-48 164 58 0 134 3 thiI tRNA sulfurtransferase Histophilus somni (strain 129Pt)
B0UUA1 6.6e-48 163 57 0 133 3 thiI tRNA sulfurtransferase Histophilus somni (strain 2336)
A6VQ53 7.18e-48 163 57 0 135 3 thiI tRNA sulfurtransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q9KTK8 1.1e-47 162 66 1 138 3 thiI tRNA sulfurtransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B1KQY3 1.67e-47 162 54 0 137 3 thiI tRNA sulfurtransferase Shewanella woodyi (strain ATCC 51908 / MS32)
A1SWV3 1.69e-46 159 56 0 137 3 thiI tRNA sulfurtransferase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q487C7 6.23e-46 158 55 0 137 3 thiI tRNA sulfurtransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q5E6Y5 6.22e-45 155 62 0 137 3 thiI tRNA sulfurtransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FBH1 6.28e-45 155 62 0 137 3 thiI tRNA sulfurtransferase Aliivibrio fischeri (strain MJ11)
Q7VKR6 8.62e-45 155 57 0 135 3 thiI tRNA sulfurtransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A5UC48 4.99e-42 147 56 0 135 3 thiI tRNA sulfurtransferase Haemophilus influenzae (strain PittEE)
Q12L31 4.34e-41 145 53 1 139 3 thiI tRNA sulfurtransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A5UEV3 5.73e-41 145 54 0 135 3 thiI tRNA sulfurtransferase Haemophilus influenzae (strain PittGG)
Q4QKG3 1.86e-39 140 54 0 135 3 thiI tRNA sulfurtransferase Haemophilus influenzae (strain 86-028NP)
Q493G5 2.02e-35 130 47 1 138 3 thiI tRNA sulfurtransferase Blochmanniella pennsylvanica (strain BPEN)
Q21NG2 2.48e-35 130 48 1 137 3 thiI tRNA sulfurtransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
C3K7D0 1.49e-34 127 47 1 137 3 thiI tRNA sulfurtransferase Pseudomonas fluorescens (strain SBW25)
A6VDN5 2.05e-34 127 45 1 137 3 thiI tRNA sulfurtransferase Pseudomonas aeruginosa (strain PA7)
Q9HU66 2.09e-34 127 47 2 138 3 thiI tRNA sulfurtransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EP8 2.09e-34 127 47 2 138 3 thiI tRNA sulfurtransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3L1 2.09e-34 127 47 2 138 3 thiI tRNA sulfurtransferase Pseudomonas aeruginosa (strain LESB58)
Q4ZLX9 7.24e-34 125 47 2 138 3 thiI tRNA sulfurtransferase Pseudomonas syringae pv. syringae (strain B728a)
Q88AM9 1.61e-33 125 46 2 138 3 thiI tRNA sulfurtransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A4XZX0 2.46e-33 124 48 2 138 3 thiI tRNA sulfurtransferase Pseudomonas mendocina (strain ymp)
C1DHW2 2.58e-33 124 47 2 138 3 thiI tRNA sulfurtransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q3KJG6 1.04e-32 122 45 2 138 3 thiI tRNA sulfurtransferase Pseudomonas fluorescens (strain Pf0-1)
Q88CY4 1.6e-32 122 43 1 137 3 thiI tRNA sulfurtransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A1U6U9 1.63e-27 108 38 2 139 3 thiI tRNA sulfurtransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_19660
Feature type CDS
Gene -
Product Sulfurtransferase required for thiamine and 4-thiouridine biosynthesis
Location 4263 - 4676 (strand: -1)
Length 414 (nucleotides) / 137 (amino acids)
In genomic island -

Contig

Accession ZDB_249
Length 4691 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2135
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00581 Rhodanese-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0607 Inorganic ion transport and metabolism (P) P Rhodanese-related sulfurtransferase

Protein Sequence

MISKNPTVKAVKEKIEAEEEKFDFAILDDVVLNAQNMDIRVIAQQSEQQVTEVEMVSELSATDVVLDIRSPDEQEAHPLKIEGTEVRTLPFYKLSTQFGDLPAETTYLLYCDRGVMSRLQALYLAEQGYTNVKVYRP

Flanking regions ( +/- flanking 50bp)

CGGAATTCTGCGGCGTGATCTCGAAAAACCCGACTGTGAAAGCGGTGAAAGAGAAAATCGAAGCCGAAGAAGAGAAATTCGATTTTGCAATTCTGGATGATGTGGTGCTCAACGCGCAGAACATGGATATCCGTGTGATCGCGCAGCAGAGTGAGCAGCAGGTTACTGAAGTGGAGATGGTATCAGAACTGTCTGCCACCGATGTGGTGCTGGATATCCGCTCGCCGGATGAACAGGAAGCGCATCCGCTGAAAATTGAGGGAACGGAAGTGCGCACACTGCCGTTCTACAAGCTCAGCACTCAGTTCGGTGATTTACCGGCGGAGACCACTTATCTGCTCTACTGCGATCGCGGGGTGATGAGCCGTCTGCAGGCGCTGTATCTGGCAGAGCAGGGCTATACCAATGTGAAGGTGTATCGTCCCTGAGTCGCAGCTGTCATTTATTTCTGAACCCCGCCTCTGTGGAGGCGGGGTTT