Homologs in group_2100

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15815 FBDBKF_15815 97.9 Morganella morganii S1 araJ putative arabinose efflux permease AraJ, MFS family
NLDBIP_19640 NLDBIP_19640 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_19580 LHKJJB_19580 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_19520 HKOGLL_19520 100.0 Morganella morganii S5 - hypothetical protein
F4V73_RS16495 F4V73_RS16495 70.8 Morganella psychrotolerans - MFS transporter
PMI_RS00495 PMI_RS00495 35.4 Proteus mirabilis HI4320 - MFS transporter

Distribution of the homologs in the orthogroup group_2100

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2100

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_19635
Feature type CDS
Gene -
Product hypothetical protein
Location 15 - 161 (strand: 1)
Length 147 (nucleotides) / 48 (amino acids)

Contig

Accession ZDB_249
Length 4691 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2100
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF21987 YajR YAM domain

Protein Sequence

MNNPDIAVKLRGQPGVRDVVIIAQERAVYVKTDTRLSNRKQLEAVLQS

Flanking regions ( +/- flanking 50bp)

TACCGGAAAATGACGTGAATAATCCGGATATTGCCGTGAAATTACGCGGACAGCCGGGTGTGCGTGATGTGGTGATTATTGCGCAGGAACGGGCGGTGTATGTGAAAACGGATACCAGACTGTCAAACCGCAAACAACTCGAAGCCGTTTTACAGAGCTGACAGGAACCGGCAACCATGCTGATGCAGGTTGCCGGATAACACTCAGTCGC